Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: VGLU1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit SLC17A7 Polyclonal Antibody | anti-SLC17A7 antibody

SLC17A7 Antibody - N-terminal region

Gene Names
SLC17A7; BNPI; VGLUT1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC17A7; Polyclonal Antibody; SLC17A7 Antibody - N-terminal region; anti-SLC17A7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLI
Sequence Length
560
Applicable Applications for anti-SLC17A7 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human VGLU1
Conjugation
Unconjugated
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: VGLU1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: VGLU1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SLC17A7 antibody
This is a rabbit polyclonal antibody against VGLU1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a vesicle-bound, sodium-dependent phosphate transporter that is specifically expressed in the neuron-rich regions of the brain. It is preferentially associated with the membranes of synaptic vesicles and functions in glutamate transport. The protein shares 82% identity with the differentiation-associated Na-dependent inorganic phosphate cotransporter and they appear to form a distinct class within the Na+/Pi cotransporter family.
Product Categories/Family for anti-SLC17A7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
vesicular glutamate transporter 1
NCBI Official Synonym Full Names
solute carrier family 17 member 7
NCBI Official Symbol
SLC17A7
NCBI Official Synonym Symbols
BNPI; VGLUT1
NCBI Protein Information
vesicular glutamate transporter 1
UniProt Protein Name
Vesicular glutamate transporter 1
UniProt Gene Name
SLC17A7
UniProt Synonym Gene Names
BNPI; VGLUT1; VGluT1
UniProt Entry Name
VGLU1_HUMAN

NCBI Description

The protein encoded by this gene is a vesicle-bound, sodium-dependent phosphate transporter that is specifically expressed in the neuron-rich regions of the brain. It is preferentially associated with the membranes of synaptic vesicles and functions in glutamate transport. The protein shares 82% identity with the differentiation-associated Na-dependent inorganic phosphate cotransporter and they appear to form a distinct class within the Na+/Pi cotransporter family. [provided by RefSeq, Jul 2008]

Uniprot Description

SLC17A7: Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate. Belongs to the major facilitator superfamily. Sodium/anion cotransporter family. VGLUT subfamily.

Protein type: Transporter, SLC family; Membrane protein, multi-pass; Vesicle; Membrane protein, integral; Transporter

Chromosomal Location of Human Ortholog: 19q13

Cellular Component: synaptic vesicle membrane; integral to membrane; presynaptic active zone; plasma membrane; excitatory synapse; cell junction

Molecular Function: sodium:inorganic phosphate symporter activity; sodium-dependent phosphate transmembrane transporter activity; inorganic phosphate transmembrane transporter activity; L-glutamate transmembrane transporter activity

Biological Process: synaptic transmission; synaptic transmission, glutamatergic; L-glutamate import; glutamate secretion; phosphate transport; long-term memory; neurotransmitter secretion; ion transport; regulation of excitatory postsynaptic membrane potential; sequestering of neurotransmitter; transmembrane transport

Research Articles on SLC17A7

Similar Products

Product Notes

The SLC17A7 slc17a7 (Catalog #AAA3207152) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC17A7 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC17A7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC17A7 slc17a7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLGFCISFGI RCNLGVAIVS MVNNSTTHRG GHVVVQKAQF SWDPETVGLI. It is sometimes possible for the material contained within the vial of "SLC17A7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.