Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SLC16A6 antibody (MBS839996) used at 1 ug/ml to detect target protein.)

Rabbit SLC16A6 Polyclonal Antibody | anti-SLC16A6 antibody

SLC16A6 antibody

Gene Names
SLC16A6; MCT6; MCT7
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC16A6; Polyclonal Antibody; SLC16A6 antibody; Polyclonal SLC16A6; Anti-SLC16A6; SLCA6-16; MCT7; Solute Carrier Family 16 Member 6; SLCA6 16; MCT6; Monocarboxylic Acid Transporter 7; anti-SLC16A6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC16A6 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
206
Applicable Applications for anti-SLC16A6 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SLC16A6 is a proton-linked monocarboxylate transporter.It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
Cross-Reactivity
Human
Immunogen
SLC16A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(SLC16A6 antibody (MBS839996) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (SLC16A6 antibody (MBS839996) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SLC16A6 antibody
Rabbit polyclonal SLC16A6 antibody
Product Categories/Family for anti-SLC16A6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
57 kDa (MW of target protein)
NCBI Official Full Name
SLC16A6 protein, partial
NCBI Official Synonym Full Names
solute carrier family 16, member 6
NCBI Official Symbol
SLC16A6
NCBI Official Synonym Symbols
MCT6; MCT7
NCBI Protein Information
monocarboxylate transporter 7
UniProt Protein Name
Monocarboxylate transporter 7
UniProt Gene Name
SLC16A6
UniProt Synonym Gene Names
MCT6; MCT7; MCT 7; MCT 6
UniProt Entry Name
MOT7_HUMAN

Uniprot Description

SLC16A6: Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. Belongs to the major facilitator superfamily. Monocarboxylate porter (TC 2.A.1.13) family.

Protein type: Membrane protein, integral; Transporter, SLC family; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17q24.2

Cellular Component: membrane; integral to plasma membrane; integral to membrane

Molecular Function: monocarboxylic acid transmembrane transporter activity; symporter activity

Biological Process: monocarboxylic acid transport

Research Articles on SLC16A6

Similar Products

Product Notes

The SLC16A6 slc16a6 (Catalog #AAA839996) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC16A6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SLC16A6 slc16a6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC16A6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.