Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human liver using SLC16A4 antibody at dilution of 1:100 (40x lens).)

Rabbit anti-Human, Rat SLC16A4 Polyclonal Antibody | anti-SLC16A4 antibody

SLC16A4 Polyclonal Antibody

Gene Names
SLC16A4; MCT4; MCT5
Reactivity
Human, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
SLC16A4; Polyclonal Antibody; SLC16A4 Polyclonal Antibody; MCT4; MCT5; anti-SLC16A4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
KNLTVSQNQSEEFYNGPNRNRLLLKSDEESDKVISWSCKQLFDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKTLGIDIMDASYLVSVAGILETVS
Sequence Length
439
Applicable Applications for anti-SLC16A4 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
Immunogen
A synthetic peptide of human SLC16A4
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Multi-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human liver using SLC16A4 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human liver using SLC16A4 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human liver cancer using SLC16A4 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human liver cancer using SLC16A4 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human gastric cancer using SLC16A4 antibody at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human gastric cancer using SLC16A4 antibody at dilution of 1:100 (40x lens).)
Product Categories/Family for anti-SLC16A4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa/42kDa/46kDa/49kDa/54kDa
NCBI Official Full Name
monocarboxylate transporter 5 isoform 2
NCBI Official Synonym Full Names
solute carrier family 16 member 4
NCBI Official Symbol
SLC16A4
NCBI Official Synonym Symbols
MCT4; MCT5
NCBI Protein Information
monocarboxylate transporter 5
UniProt Protein Name
Monocarboxylate transporter 5
UniProt Gene Name
SLC16A4
UniProt Synonym Gene Names
MCT4; MCT5; MCT 5; MCT 4

Uniprot Description

Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate ().

Research Articles on SLC16A4

Similar Products

Product Notes

The SLC16A4 slc16a4 (Catalog #AAA9134810) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC16A4 Polyclonal Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC16A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the SLC16A4 slc16a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KNLTVSQNQS EEFYNGPNRN RLLLKSDEES DKVISWSCKQ LFDISLFRNP FFYIFTWSFL LSQLAYFIPT FHLVARAKTL GIDIMDASYL VSVAGILETV S. It is sometimes possible for the material contained within the vial of "SLC16A4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.