Western Blot (WB)
(SLC15A4 antibody (MBS5300967) used at 1 ug/ml to detect target protein.)
Rabbit SLC15A4 Polyclonal Antibody | anti-SLC15A4 antibody
SLC15A4 antibody
Gene Names
SLC15A4; PHT1; PTR4; FP12591
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC15A4; Polyclonal Antibody; SLC15A4 antibody; Polyclonal SLC15A4; Anti-SLC15A4; PHT1; SLCA4-15; Solute Carrier Family 15 Member 4; PTR4; FP12591; SLCA4 15; anti-SLC15A4 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
SLC15A4 antibody was raised against the middle region of SLC15A4
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC15A4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
577
Applicable Applications for anti-SLC15A4 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
SLC15A4 is a proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides.
Cross-Reactivity
Human
Immunogen
SLC15A4 antibody was raised using the middle region of SLC15A4 corresponding to a region with amino acids GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(SLC15A4 antibody (MBS5300967) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(SLC15A4 antibody (MBS5300967) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-SLC15A4 antibody
Rabbit polyclonal SLC15A4 antibody raised against the middle region of SLC15A4
Product Categories/Family for anti-SLC15A4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
62 kDa (MW of target protein)
NCBI Official Full Name
solute carrier family 15 member 4
NCBI Official Synonym Full Names
solute carrier family 15 (oligopeptide transporter), member 4
NCBI Official Symbol
SLC15A4
NCBI Official Synonym Symbols
PHT1; PTR4; FP12591
NCBI Protein Information
solute carrier family 15 member 4
UniProt Protein Name
Solute carrier family 15 member 4
Protein Family
UniProt Gene Name
SLC15A4
UniProt Synonym Gene Names
PHT1; PTR4; hPHT1
UniProt Entry Name
S15A4_HUMAN
Uniprot Description
SLC15A4: Proton oligopeptide cotransporter. Transports free histidine and certain di- and tripeptides. Belongs to the PTR2/POT transporter (TC 2.A.17) family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Transporter, SLC family; Membrane protein, multi-pass; Transporter; Membrane protein, integral
Chromosomal Location of Human Ortholog: 12q24.32
Cellular Component: lysosomal membrane; integral to membrane
Molecular Function: L-histidine transmembrane transporter activity; symporter activity
Biological Process: protein transport; ion transport; oligopeptide transport; transmembrane transport
Research Articles on SLC15A4
Similar Products
Product Notes
The SLC15A4 slc15a4 (Catalog #AAA5300967) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC15A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the SLC15A4 slc15a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC15A4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
