Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit SLC14A1 Polyclonal Antibody | anti-SLC14A1 antibody

SLC14A1 antibody - C-terminal region

Gene Names
SLC14A1; JK; UT1; UTE; HUT11; RACH1; RACH2; UT-B1; HsT1341
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SLC14A1; Polyclonal Antibody; SLC14A1 antibody - C-terminal region; anti-SLC14A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM
Sequence Length
389
Applicable Applications for anti-SLC14A1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Goat: 93%; Horse: 83%; Human: 100%; Mouse: 83%; Pig: 93%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SLC14A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Western Blot (WB)

(Host: RabbitTarget Name: SLC14A1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLC14A1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-SLC14A1 Antibody Titration: 0.25ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC14A1 Antibody Titration: 0.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-SLC14A1 antibody
This is a rabbit polyclonal antibody against SLC14A1. It was validated on Western Blot and immunohistochemistry

Target Description: SLC14A1 is a specialized low-affinity urea transporter. It mediates urea transport in erythrocytes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
urea transporter 1 isoform 2
NCBI Official Synonym Full Names
solute carrier family 14 member 1 (Kidd blood group)
NCBI Official Symbol
SLC14A1
NCBI Official Synonym Symbols
JK; UT1; UTE; HUT11; RACH1; RACH2; UT-B1; HsT1341
NCBI Protein Information
urea transporter 1
UniProt Protein Name
Urea transporter 1
Protein Family
UniProt Gene Name
SLC14A1
UniProt Synonym Gene Names
HUT11; JK; RACH1; UT1; UTE
UniProt Entry Name
UT1_HUMAN

NCBI Description

The protein encoded by this gene is a membrane transporter that mediates urea transport in erythrocytes. This gene forms the basis for the Kidd blood group system. [provided by RefSeq, Mar 2009]

Research Articles on SLC14A1

Similar Products

Product Notes

The SLC14A1 slc14a1 (Catalog #AAA3208858) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC14A1 antibody - C-terminal region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SLC14A1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SLC14A1 slc14a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSSPLMCLHA AIGSLLGIAA GLSLSAPFEN IYFGLWGFNS SLACIAMGGM. It is sometimes possible for the material contained within the vial of "SLC14A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.