Western Blot (WB)
(Host: RabbitTarget Name: Slamf1Sample Type: Mouse Spleen lysatesAntibody Dilution: 1.0ug/ml)
Rabbit Slamf1 Polyclonal Antibody | anti-SLAMF1 antibody
Slamf1 Antibody - middle region
Gene Names
Slamf1; Slam; CD150; IPO-3; CDw150; ESTM51; AA177906; 4933415F16
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Slamf1; Polyclonal Antibody; Slamf1 Antibody - middle region; anti-SLAMF1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSR
Sequence Length
343
Applicable Applications for anti-SLAMF1 antibody
Western Blot (WB)
Homology
Cow: 77%; Dog: 85%; Goat: 77%; Guinea Pig: 80%; Horse: 85%; Human: 100%; Mouse: 87%; Pig: 100%; Rabbit: 80%; Rat: 93%; Sheep: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Mouse Slamf1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Slamf1Sample Type: Mouse Spleen lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Slamf1Sample Type: Mouse Spleen lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SLAMF1 antibody
This is a rabbit polyclonal antibody against Slamf1. It was validated on Western Blot
Target Description: Slamf1 is a high-affinity self-ligand important in bidirectional T-cell to B-cell stimulation. SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates.
Target Description: Slamf1 is a high-affinity self-ligand important in bidirectional T-cell to B-cell stimulation. SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates.
Product Categories/Family for anti-SLAMF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
signaling lymphocytic activation molecule isoform 1
NCBI Official Synonym Full Names
signaling lymphocytic activation molecule family member 1
NCBI Official Symbol
Slamf1
NCBI Official Synonym Symbols
Slam; CD150; IPO-3; CDw150; ESTM51; AA177906; 4933415F16
NCBI Protein Information
signaling lymphocytic activation molecule
UniProt Protein Name
Signaling lymphocytic activation molecule
Protein Family
UniProt Gene Name
Slamf1
UniProt Synonym Gene Names
Slam
UniProt Entry Name
SLAF1_MOUSE
Uniprot Description
SLAM: a type I membrane protein present on the surface of B cells, T cells and CD83+ dendritic cells. A high-affinity self-ligand considered to be important in bidirectional T <-> B-cell stimulation. SLAM-induced signal-transduction events in T lymphocytes are different from those in B cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A (SAP) acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (SHP-2)-dependent signal transduction operates. Its cytoplasmic domain interacts with SAP through part of its SH2 domain, and with SHP-2. Three alternatively spliced isoforms have been described.
Protein type: Receptor, misc.; Membrane protein, integral
Cellular Component: cell surface; membrane; integral to membrane; plasma membrane; phagocytic vesicle; external side of plasma membrane
Molecular Function: protein binding; receptor activity
Biological Process: regulation of catalytic activity; regulation of vesicle fusion; lymphocyte activation
Research Articles on SLAMF1
Similar Products
Product Notes
The SLAMF1 slamf1 (Catalog #AAA3215713) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Slamf1 Antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Slamf1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLAMF1 slamf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QVSPPEIKVL NKTQENENGT CSLLLACTVK KGDHVTYSWS DEAGTHLLSR. It is sometimes possible for the material contained within the vial of "Slamf1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
