Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit SIRT5 Polyclonal Antibody | anti-SIRT5 antibody

SIRT5 antibody - middle region

Gene Names
SIRT5; SIR2L5
Reactivity
Cow, Goat, Human, Mouse, Pig, Rabbit
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
SIRT5; Polyclonal Antibody; SIRT5 antibody - middle region; anti-SIRT5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Goat, Human, Mouse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILE
Sequence Length
299
Applicable Applications for anti-SIRT5 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 77%; Goat: 77%; Human: 100%; Mouse: 77%; Pig: 85%; Rabbit: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SIRT5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Immunohistochemistry (IHC)

(Human Lung )

Immunohistochemistry (IHC) (Human Lung )

Immunohistochemistry (IHC)

(Rabbit Anti-SIRT5 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-SIRT5 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-SIRT5 Antibody Titration: 1.0-2.0ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-SIRT5 Antibody Titration: 1.0-2.0ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-SIRT5 antibody
This is a rabbit polyclonal antibody against SIRT5. It was validated on Western Blot and immunohistochemistry

Target Description: SIRT5 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family.
Product Categories/Family for anti-SIRT5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
NAD-dependent protein deacylase sirtuin-5, mitochondrial isoform 2
NCBI Official Synonym Full Names
sirtuin 5
NCBI Official Symbol
SIRT5
NCBI Official Synonym Symbols
SIR2L5
NCBI Protein Information
NAD-dependent protein deacylase sirtuin-5, mitochondrial
UniProt Protein Name
NAD-dependent protein deacylase sirtuin-5, mitochondrial
UniProt Gene Name
SIRT5
UniProt Synonym Gene Names
SIR2L5
UniProt Entry Name
SIR5_HUMAN

NCBI Description

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2010]

Research Articles on SIRT5

Similar Products

Product Notes

The SIRT5 sirt5 (Catalog #AAA3200910) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIRT5 antibody - middle region reacts with Cow, Goat, Human, Mouse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's SIRT5 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SIRT5 sirt5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSGKGAPEPG TQDASIPVEK LPRCEEAGCG GLLRPHVVWF GENLDPAILE. It is sometimes possible for the material contained within the vial of "SIRT5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.