Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SHOC2Sample Tissue: Human Fetal KidneyAntibody Dilution: 1ug/ml)

Rabbit SHOC2 Polyclonal Antibody | anti-SHOC2 antibody

SHOC2 Antibody - N-terminal region

Gene Names
SHOC2; SOC2; SUR8; SIAA0862
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SHOC2; Polyclonal Antibody; SHOC2 Antibody - N-terminal region; anti-SHOC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NPAPGTRKKSSNAEVIKELNKCREENSMRLDLSKRSIHILPSSIKELTQL
Sequence Length
536
Applicable Applications for anti-SHOC2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SHOC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SHOC2Sample Tissue: Human Fetal KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SHOC2Sample Tissue: Human Fetal KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-SHOC2 antibody
This is a rabbit polyclonal antibody against SHOC2. It was validated on Western Blot

Target Description: This gene encodes a protein that consists almost entirely of leucine-rich repeats, a domain implicated in protein-protein interactions. The protein may function as a scaffold linking RAS to downstream signal transducers in the RAS/ERK MAP kinase signaling cascade. Mutations in this gene have been associated with Noonan-like syndrome with loose anagen hair.
Product Categories/Family for anti-SHOC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
leucine-rich repeat protein SHOC-2 isoform 1
NCBI Official Synonym Full Names
SHOC2 leucine rich repeat scaffold protein
NCBI Official Symbol
SHOC2
NCBI Official Synonym Symbols
SOC2; SUR8; SIAA0862
NCBI Protein Information
leucine-rich repeat protein SHOC-2
UniProt Protein Name
Leucine-rich repeat protein SHOC-2
UniProt Gene Name
SHOC2
UniProt Synonym Gene Names
KIAA0862
UniProt Entry Name
SHOC2_HUMAN

NCBI Description

This gene encodes a protein that consists almost entirely of leucine-rich repeats, a domain implicated in protein-protein interactions. The protein may function as a scaffold linking RAS to downstream signal transducers in the RAS/ERK MAP kinase signaling cascade. Mutations in this gene have been associated with Noonan-like syndrome with loose anagen hair. [provided by RefSeq, May 2010]

Uniprot Description

SHOC2: Regulatory subunit of protein phosphatase 1 (PP1c) that acts as a M-Ras/MRAS effector and participates in MAPK pathway activation. Upon M-Ras/MRAS activation, targets PP1c to specifically dephosphorylate the 'Ser-259' inhibitory site of RAF1 kinase and stimulate RAF1 activity at specialized signaling complexes. Defects in SHOC2 are the cause of Noonan syndrome-like disorder with loose anagen hair (NSLH). A syndrome characterized by Noonan dysmorphic features such as macrocephaly, high forehead, hypertelorism, palpebral ptosis, low-set and posteriorly rotated ears, short and webbed neck, pectus anomalies, in association with pluckable, sparse, thin and slow-growing hair. Belongs to the SHOC2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 10q25

Cellular Component: nucleoplasm; cytoplasm; protein phosphatase type 1 complex; nucleus

Molecular Function: protein phosphatase regulator activity; protein phosphatase binding

Biological Process: fibroblast growth factor receptor signaling pathway; regulation of catalytic activity; Ras protein signal transduction; positive regulation of Ras protein signal transduction

Disease: Noonan Syndrome-like Disorder With Loose Anagen Hair

Research Articles on SHOC2

Similar Products

Product Notes

The SHOC2 shoc2 (Catalog #AAA3216760) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHOC2 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SHOC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SHOC2 shoc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NPAPGTRKKS SNAEVIKELN KCREENSMRL DLSKRSIHIL PSSIKELTQL. It is sometimes possible for the material contained within the vial of "SHOC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.