Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence analysis of U-2 OS cells using SHMT1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit SHMT1 Polyclonal Antibody | anti-SHMT1 antibody

SHMT1 Rabbit pAb

Gene Names
SHMT1; SHMT; CSHMT
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity purification
Synonyms
SHMT1; Polyclonal Antibody; SHMT1 Rabbit pAb; CSHMT; SHMT; anti-SHMT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
FKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPDF
Applicable Applications for anti-SHMT1 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 285-444 of human SHMT1 (NP_683718.1).
Cellular Location
Cytoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence analysis of U-2 OS cells using SHMT1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of U-2 OS cells using SHMT1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-SHMT1 antibody
Background: This gene encodes the cytosolic form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5, 10-methylene tetrahydrofolate. This reaction provides one-carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. A pseudogene of this gene is located on the short arm of chromosome 1. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-SHMT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
483
NCBI Official Full Name
Serine hydroxymethyltransferase, cytosolic
NCBI Official Synonym Full Names
serine hydroxymethyltransferase 1 (soluble)
NCBI Official Symbol
SHMT1
NCBI Official Synonym Symbols
SHMT; CSHMT
NCBI Protein Information
serine hydroxymethyltransferase, cytosolic; serine methylase; glycine hydroxymethyltransferase; cytoplasmic serine hydroxymethyltransferase
UniProt Protein Name
Serine hydroxymethyltransferase, cytosolic
UniProt Gene Name
SHMT1
UniProt Synonym Gene Names
SHMT
UniProt Entry Name
GLYC_HUMAN

NCBI Description

This gene encodes the cytosolic form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one-carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. A pseudogene of this gene is located on the short arm of chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Uniprot Description

SHMT1: Interconversion of serine and glycine. Belongs to the SHMT family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cofactor and Vitamin Metabolism - one carbon pool by folate; EC 2.1.2.1; Amino Acid Metabolism - glycine, serine and threonine; Energy Metabolism - methane; Other Amino Acids Metabolism - cyanoamino acid; Lyase; Methyltransferase; Mitochondrial

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; cytosol; nucleus

Molecular Function: L-allo-threonine aldolase activity; amino acid binding; protein homodimerization activity; glycine hydroxymethyltransferase activity; pyridoxal phosphate binding

Biological Process: purine base biosynthetic process; vitamin metabolic process; folic acid metabolic process; L-serine catabolic process; glycine biosynthetic process from serine; water-soluble vitamin metabolic process; carnitine biosynthetic process; protein tetramerization; protein homotetramerization

Research Articles on SHMT1

Similar Products

Product Notes

The SHMT1 shmt1 (Catalog #AAA9142553) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHMT1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SHMT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500-1:2000 IF: 1:50-1:100. Researchers should empirically determine the suitability of the SHMT1 shmt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FKVYQHQVVA NCRALSEALT ELGYKIVTGG SDNHLILVDL RSKGTDGGRA EKVLEACSIA CNKNTCPGDR SALRPSGLRL GTPALTSRGL LEKDFQKVAH FIHRGIELTL QIQSDTGVRA TLKEFKERLA GDKYQAAVQA LREEVESFAS LFPLPGLPDF. It is sometimes possible for the material contained within the vial of "SHMT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.