Rabbit SHH Polyclonal Antibody | anti-SHH antibody

SHH antibody - N-terminal region

Cat. Num. AAA3207272

• Gene Names: SHH; TPT; HHG1; HLP3; HPE3; SMMCI; ShhNC; TPTPS; MCOPCB5
• Reactivity: Predicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish, Chicken (Tested Reactivity: Human, Mouse, Chicken)
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: SHH; Polyclonal Antibody; SHH antibody - N-terminal region; anti-SHH antibody

• Host: Rabbit
• Reactivity: Predicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish, Chicken (Tested Reactivity: Human, Mouse, Chicken)
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
• Sequence: Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT
• Sequence Length: 462

• Applicable Applications for anti-SHH antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SHH
• Protein Size: 462 amino acids
• Protein Interactions: UBC; SEL1L; DERL2; DERL1; SYVN1; HHIP; PTCH2; PTCH1; SHH; ADCYAP1; GAS1.
• Blocking Peptide: For anti-SHH (MBS3207272) antibody catalog is MBS3232237
• Replacement Items: This antibody may replace item sc-1194 from Santa Cruz Biotechnology.
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Chicken embryosChicken embryosPrimary antibody: 1:1000 (MBS3207272) anti -shhSecondary Antibody: 1:500 (MBS3249294) goat anti-rabbit HRP conjugated)

Immunohistochemistry (IHC)

(Rabbit Anti-SHH AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: Plasma membrane, CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC)

(Sample Type :Human glioma cellsPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-GFPSecondary Antibody Dilution :1:500Color/Signal Descriptions :1. SHH: Green 2. DAPI: Blue 3. MergeGene Name :SHHSubmitted by :ELIAS EL HABR, PhD, Post-Doctoral fellow, INSERM U894 Glial Plasticity Team, Psychiatry& Neurosciences Center, St Anne Hospital, 2 Ter, Rue d'Alesia, 75014 Paris )

Western Blot (WB)

(Host: MouseTarget Name: SHHSample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: SHHSample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-SHH Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Related Product Information for anti-SHH antibody

This is a rabbit polyclonal antibody against SHH. It was validated on Western Blot and immunohistochemistry

Target Description: SHH is a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE). It is also thought that mutations in its gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.This gene, which is expressed only during embryogenesis, encodes a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. In addition, it is thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.

Product Categories/Family for anti-SHH antibody

Polyclonal; RNA Binding Proteins; Neurobiology; Signal Proteins; Membrane Protein; Transcription Regulation; Drugs and Drug Metabolism; Developmental Biology; Neuroscience; Signal Transduction; Disease Related; Immunohistochemistry; Pathways In Cancer; Ce

NCBI and Uniprot Product Information

• NCBI GI #: 4506939
• NCBI GeneID: 6469
• NCBI Accession #: NP_000184
• NCBI GenBank Nucleotide #: NM_000193
• UniProt Accession #: Q15465
• Molecular Weight: 28kDa
• NCBI Official Full Name: sonic hedgehog protein isoform 1 preproprotein
• NCBI Official Synonym Full Names: sonic hedgehog signaling molecule
• NCBI Official Symbol: SHH
• NCBI Official Synonym Symbols: TPT; HHG1; HLP3; HPE3; SMMCI; ShhNC; TPTPS; MCOPCB5
• NCBI Protein Information: sonic hedgehog protein
• UniProt Protein Name: Sonic hedgehog protein
• Protein Family: Sonic hedgehog protein
• UniProt Gene Name: SHH
• UniProt Synonym Gene Names: SHH
• UniProt Entry Name: SHH_HUMAN

NCBI Description

This gene encodes a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. It is also thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities. Additionally, mutations in a long range enhancer located approximately 1 megabase upstream of this gene disrupt limb patterning and can result in preaxial polydactyly. [provided by RefSeq, Jul 2008]

Uniprot Description

SHH: Binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. In the absence of SHH, PTC represses the constitutive signaling activity of SMO. Also regulates another target, the gli oncogene. Intercellular signal essential for a variety of patterning events during development: signal produced by the notochord that induces ventral cell fate in the neural tube and somites, and the polarizing signal for patterning of the anterior-posterior axis of the developing limb bud. Displays both floor plate- and motor neuron-inducing activity. The threshold concentration of N-product required for motor neuron induction is 5-fold lower than that required for floor plate induction. Interacts with HHATL/GUP1 which negatively regulates HHAT-mediated palmitoylation of the SHH N-terminus. N-product is active as a multimer. Expressed in fetal intestine, liver, lung, and kidney. Not expressed in adult tissues. Belongs to the hedgehog family.

Protein type: Cell development/differentiation; Cell cycle regulation; Oncoprotein; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 7q36

Cellular Component: extracellular matrix; extracellular space; cell surface; endoplasmic reticulum lumen; plasma membrane; extracellular region; cytosol; nucleus; lipid raft

Molecular Function: laminin-1 binding; peptidase activity; morphogen activity; protein binding; glycosaminoglycan binding; zinc ion binding; patched binding; calcium ion binding; glycoprotein binding

Biological Process: prostate gland development; central nervous system development; embryonic skeletal development; positive regulation of transcription, DNA-dependent; telencephalon regionalization; embryonic foregut morphogenesis; male genitalia development; inner ear development; neural crest cell migration; embryonic limb morphogenesis; hindbrain development; positive regulation of neuroblast proliferation; camera-type eye development; myotube differentiation; neuron fate commitment; intermediate filament organization; osteoblast development; positive regulation of skeletal muscle cell proliferation; positive regulation of cell division; regulation of proteolysis; positive regulation of transcription from RNA polymerase II promoter; embryonic digit morphogenesis; negative regulation of apoptosis; embryonic forelimb morphogenesis; axon guidance; granule cell precursor proliferation; ventral midline development; spinal cord dorsal/ventral patterning; thalamus development; negative regulation of transcription from RNA polymerase II promoter; palate development; positive regulation of striated muscle cell differentiation; Bergmann glial cell differentiation; negative regulation of T cell proliferation; pancreas development; forebrain development; positive regulation of cell proliferation; thyroid gland development; heart looping; vasculogenesis; negative regulation of cell migration; positive thymic T cell selection; intein-mediated protein splicing; regulation of odontogenesis; androgen metabolic process; spinal cord motor neuron differentiation; pattern specification process; odontogenesis of dentine-containing teeth; regulation of cell proliferation; stem cell development; negative regulation of cell differentiation; embryonic development; dorsal/ventral pattern formation; positive regulation of protein import into nucleus; ureteric bud branching; hindgut morphogenesis; lung development; negative regulation of alpha-beta T cell differentiation; heart development; T cell differentiation in the thymus; CD4-positive or CD8-positive, alpha-beta T cell lineage commitment; lymphoid progenitor cell differentiation; Wnt receptor signaling pathway through beta-catenin; embryonic pattern specification; proteolysis; positive regulation of T cell differentiation in the thymus; cell-cell signaling; embryonic digestive tract morphogenesis; midbrain development; ectoderm development; positive regulation of smoothened signaling pathway; positive regulation of oligodendrocyte differentiation; oligodendrocyte development; activation of hh target transcription factor; striated muscle development; endocytosis; positive regulation of skeletal muscle development; negative thymic T cell selection; patterning of blood vessels; branching morphogenesis of a tube; polarity specification of anterior/posterior axis; metanephros development; cell fate specification; embryonic hindlimb morphogenesis; positive regulation of Wnt receptor signaling pathway; dorsoventral neural tube patterning; organ formation; smoothened signaling pathway; hair follicle morphogenesis; thymus development; smoothened signaling pathway in regulation of granule cell precursor cell proliferation; positive regulation of immature T cell proliferation in the thymus; negative regulation of proteasomal ubiquitin-dependent protein catabolic process; formation of anatomical boundary; myoblast differentiation; limb bud formation; establishment of cell polarity; neuroblast proliferation; blood coagulation; cell development; positive regulation of alpha-beta T cell differentiation

Disease: Solitary Median Maxillary Central Incisor; Schizencephaly; Microphthalmia, Isolated, With Coloboma 5; Holoprosencephaly 3