Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: SHC1Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Rabbit anti-Human SHC1 Polyclonal Antibody | anti-SHC1 antibody

SHC1 Antibody - middle region

Gene Names
SHC1; SHC; SHCA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SHC1; Polyclonal Antibody; SHC1 Antibody - middle region; anti-SHC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EPPDHQYYNDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHLGA
Sequence Length
167
Applicable Applications for anti-SHC1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SHC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: SHC1Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: SHC1Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: SHC1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SHC1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SHC1 antibody
This gene encodes three main isoforms that differ in activities and subcellular location. While all three are adapter proteins in signal transduction pathways, the longest (p66Shc) may be involved in regulating life span and the effects of reactive oxygen species. The other two isoforms, p52Shc and p46Shc, link activated receptor tyrosine kinases to the Ras pathway by recruitment of the GRB2/SOS complex. p66Shc is not involved in Ras activation. Unlike the other two isoforms, p46Shc is targeted to the mitochondrial matrix. Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SHC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63 kDa
NCBI Official Full Name
SHC-transforming protein 1 isoform 3
NCBI Official Synonym Full Names
SHC adaptor protein 1
NCBI Official Symbol
SHC1
NCBI Official Synonym Symbols
SHC; SHCA
NCBI Protein Information
SHC-transforming protein 1
UniProt Protein Name
SHC-transforming protein 1
Protein Family
UniProt Gene Name
SHC1
UniProt Synonym Gene Names
SHC; SHCA; SH2 domain protein C1
UniProt Entry Name
SHC1_HUMAN

NCBI Description

This gene encodes three main isoforms that differ in activities and subcellular location. While all three are adapter proteins in signal transduction pathways, the longest (p66Shc) may be involved in regulating life span and the effects of reactive oxygen species. The other two isoforms, p52Shc and p46Shc, link activated receptor tyrosine kinases to the Ras pathway by recruitment of the GRB2/SOS complex. p66Shc is not involved in Ras activation. Unlike the other two isoforms, p46Shc is targeted to the mitochondrial matrix. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011]

Uniprot Description

SHC1: an adaptor protein containing a SH2 domain and a PID domain within a PH domain-like fold. Couples activated growth factor receptors to signaling pathways. Participates in a signaling cascade initiated by activated KIT and KITLG/SCF. Six human isoforms are produced by alternative promoter usage and alternative splicing. Isoforms p66, p52 and p46 (P29353-1, -2, and -3), produced by alternative initiation, variously regulate growth factor signaling, oncogenesis, intracellular oxidant levels, and apoptosis. Isoforms p46 and p52, once phosphorylated, couple activated receptor tyrosine kinases to Ras via the recruitment of the GRB2/SOS complex, thus initiating the cytoplasmic proliferative Ras signaling cascade in various non-neuronal systems. Isoform p66 does not mediate Ras activation, but associates with mitochondria where it controls intracellular redox status, mitochondrial permeability, life span, and stress-induced apoptosis. p66 acts as a downstream target of the tumor suppressor p53 and is required for the ability of stress-activated p53 to induce elevation of intracellular oxidants, cytochrome c release and apoptosis. P66 deletion in mice decreases the incidence of aging-associated diseases, such as atherosclerosis, and significantly prolongs life span. Participates in signaling downstream of TIE2, the tyrosine kinase receptor for angiopoietin, and plays a role in the regulation of endothelial cell migration and sprouting angiogenesis. Interacts with tyrosine-phosphorylated CD3T, DDR2, LRP1, IRS4, SHP, FLT4, PDGFRB, TIE2, TrkA, -B and -C. Interacts with the NPXY motif of tyrosine-phosphorylated IGF1R and INSR in vitro via the PID domain. p66Shc is known to be activated by the mutant SOD1 associated with familial forms of amyotrophic lateral sclerosis (ALS), causing a decrease in the activity of Rac1 through a redox-sensitive regulation. In case of oxidative conditions, phosphorylation at S36 of isoform p66Shc, leads to mitochondrial accumulation p66 plays a role in mediating mitophagy and determining neuronal cell fate following acute oxygen glucose deprivation. Isoform p46 is localized to the mitochondria matrix. Targeting of isoform p46Shc to mitochondria is mediated by its first 32 amino acids, which behave as a bona fide mitochondrial targeting sequence. Isoform p52Shc and isoform p66Shc, that contain the same sequence but more internally located, display a different subcellular localization.

Protein type: Adaptor/scaffold; Mitochondrial; Apoptosis; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: mitochondrial matrix; plasma membrane; cytosol

Molecular Function: insulin-like growth factor receptor binding; protein binding; ephrin receptor binding; neurotrophin TRKA receptor binding; protein-tyrosine kinase activity; phospholipid binding; transmembrane receptor protein tyrosine kinase adaptor protein activity; protein kinase binding; insulin receptor binding; epidermal growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; platelet activation; peptidyl-tyrosine phosphorylation; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; activation of MAPK activity; unfolded protein response; heart development; regulation of epidermal growth factor receptor activity; MAPKKK cascade; cell-cell adhesion; unfolded protein response, activation of signaling protein activity; cellular protein metabolic process; regulation of growth; Ras protein signal transduction; positive regulation of cell proliferation; actin cytoskeleton reorganization; insulin receptor signaling pathway; innate immune response; angiogenesis; blood coagulation; leukocyte migration; positive regulation of DNA replication

Research Articles on SHC1

Similar Products

Product Notes

The SHC1 shc1 (Catalog #AAA3220409) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHC1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SHC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SHC1 shc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EPPDHQYYND FPGKEPPLGG VVDMRLREGA APGAARPTAP NAQTPSHLGA. It is sometimes possible for the material contained within the vial of "SHC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.