Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SHANK2 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

Rabbit SHANK2 Polyclonal Antibody | anti-SHANK2 antibody

SHANK2 antibody - C-terminal region

Gene Names
SHANK2; SHANK; AUTS17; CORTBP1; CTTNBP1; ProSAP1; SPANK-3
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SHANK2; Polyclonal Antibody; SHANK2 antibody - C-terminal region; anti-SHANK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLVKQKKSDTPQSPSLNSSQPTNSADSKKPASLSNCLPASFLPPPESFDA
Sequence Length
1153
Applicable Applications for anti-SHANK2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Guinea Pig: 86%; Human: 100%; Mouse: 77%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SHANK2 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

Western Blot (WB) (WB Suggested Anti-SHANK2 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Related Product Information for anti-SHANK2 antibody
This is a rabbit polyclonal antibody against SHANK2. It was validated on Western Blot

Target Description: This gene encodes a protein that is a member of the Shank family of synaptic proteins that may function as molecular scaffolds in the postsynaptic density (PSD). Shank proteins contain multiple domains for protein-protein interaction, including ankyrin repeats, an SH3 domain, a PSD-95/Dlg/ZO-1 domain, a sterile alpha motif domain, and a proline-rich region. This particular family member contains a PDZ domain, a consensus sequence for cortactin SH3 domain-binding peptides and a sterile alpha motif. The alternative splicing demonstrated in Shank genes has been suggested as a mechanism for regulating the molecular structure of Shank and the spectrum of Shank-interacting proteins in the PSDs of adult and developing brain. Two alternative splice variants, encoding distinct isoforms, are reported. Additional splice variants exist but their full-length nature has not been determined.
Product Categories/Family for anti-SHANK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
126kDa
NCBI Official Full Name
SH3 and multiple ankyrin repeat domains 2, isoform CRA_e, partial
NCBI Official Synonym Full Names
SH3 and multiple ankyrin repeat domains 2
NCBI Official Symbol
SHANK2
NCBI Official Synonym Symbols
SHANK; AUTS17; CORTBP1; CTTNBP1; ProSAP1; SPANK-3
NCBI Protein Information
SH3 and multiple ankyrin repeat domains protein 2
UniProt Protein Name
SH3 and multiple ankyrin repeat domains protein 2
UniProt Gene Name
SHANK2
UniProt Synonym Gene Names
CORTBP1; KIAA1022; PROSAP1; Shank2; CortBP1
UniProt Entry Name
SHAN2_HUMAN

NCBI Description

This gene encodes a protein that is a member of the Shank family of synaptic proteins that may function as molecular scaffolds in the postsynaptic density of excitatory synapses. Shank proteins contain multiple domains for protein-protein interaction, including ankyrin repeats, and an SH3 domain. This particular family member contains a PDZ domain, a consensus sequence for cortactin SH3 domain-binding peptides and a sterile alpha motif. The alternative splicing demonstrated in Shank genes has been suggested as a mechanism for regulating the molecular structure of Shank and the spectrum of Shank-interacting proteins in the postsynaptic densities of the adult and developing brain. Alterations in the encoded protein may be associated with susceptibility to autism spectrum disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Uniprot Description

SHANK2 iso4: Seems to be an adapter protein in the postsynaptic density (PSD) of excitatory synapses that interconnects receptors of the postsynaptic membrane including NMDA-type and metabotropic glutamate receptors, and the actin-based cytoskeleton. May play a role in the structural and functional organization of the dendritic spine and synaptic junction. Defects in SHANK2 are a cause of susceptibility to autism type 17 (AUTS17). Autism is a complex multifactorial, pervasive developmental disorder characterized by impairments in reciprocal social interaction and communication, restricted and stereotyped patterns of interests and activities, and the presence of developmental abnormalities by 3 years of age. Most individuals with autism also manifest moderate mental retardation. Belongs to the SHANK family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 11q13.2

Cellular Component: postsynaptic membrane; neuron projection; photoreceptor inner segment; growth cone; photoreceptor outer segment; cell soma; brush border membrane; apical plasma membrane; postsynaptic density; plasma membrane; neurofilament; dendritic spine; ionotropic glutamate receptor complex; cell junction

Molecular Function: ionotropic glutamate receptor binding; protein binding; GKAP/Homer scaffold activity; SH3 domain binding

Biological Process: synaptogenesis; adult behavior; social behavior; learning; memory

Disease: Autism, Susceptibility To, 17

Research Articles on SHANK2

Similar Products

Product Notes

The SHANK2 shank2 (Catalog #AAA3216273) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SHANK2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SHANK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SHANK2 shank2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLVKQKKSDT PQSPSLNSSQ PTNSADSKKP ASLSNCLPAS FLPPPESFDA. It is sometimes possible for the material contained within the vial of "SHANK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.