Western Blot (WB)
(SH3GL3 polyclonal antibody. Western Blot analysis of SH3GL3 expression in rat brain.)
Mouse anti-Human, Rat SH3GL3 Polyclonal Antibody | anti-SH3GL3 antibody
SH3GL3 (Endophilin-A3, EEN-B2, Endophilin-3, SH3 Domain Protein 2C, SH3 Domain-containing GRB2-like Protein 3, CNSA3, SH3D2C)
Gene Names
SH3GL3; CNSA3; EEN-B2; SH3D2C; SH3P13; HsT19371; EEN-2B-L3
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
SH3GL3; Polyclonal Antibody; SH3GL3 (Endophilin-A3; EEN-B2; Endophilin-3; SH3 Domain Protein 2C; SH3 Domain-containing GRB2-like Protein 3; CNSA3; SH3D2C); Anti -SH3GL3 (Endophilin-A3; anti-SH3GL3 antibody
Host
Mouse
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SH3GL3. Species Crossreactivity: rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTAYSRLEPAD
Applicable Applications for anti-SH3GL3 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SH3GL3, aa1-288 (AAH42864.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(SH3GL3 polyclonal antibody. Western Blot analysis of SH3GL3 expression in rat brain.)
Western Blot (WB)
(SH3GL3 polyclonal antibody. Western Blot analysis of SH3GL3 expression in rat brain.)
Western Blot (WB)
(Western Blot analysis of SH3GL3 expression in transfected 293T cell line by SH3GL3 polyclonal antibody. Lane 1: SH3GL3 transfected lysate (31.68kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of SH3GL3 expression in transfected 293T cell line by SH3GL3 polyclonal antibody. Lane 1: SH3GL3 transfected lysate (31.68kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SH3GL3 antibody
Implicated in endocytosis. May recruit other proteins to membranes with high curvature.
Product Categories/Family for anti-SH3GL3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
39,285 Da
NCBI Official Full Name
SH3GL3
NCBI Official Synonym Full Names
SH3-domain GRB2-like 3
NCBI Official Symbol
SH3GL3
NCBI Official Synonym Symbols
CNSA3; EEN-B2; SH3D2C; SH3P13; HsT19371; EEN-2B-L3
NCBI Protein Information
endophilin-A3; endophilin-3; SH3 domain protein 2C; SH3 domain-containing GRB2-like protein 3
UniProt Protein Name
Endophilin-A3
Protein Family
UniProt Gene Name
SH3GL3
UniProt Synonym Gene Names
CNSA3; SH3D2C
UniProt Entry Name
SH3G3_HUMAN
Uniprot Description
SH3GL3: Implicated in endocytosis. May recruit other proteins to membranes with high curvature. Belongs to the endophilin family. 4 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 15q24
Cellular Component: early endosome membrane
Molecular Function: identical protein binding; protein binding; lipid binding
Biological Process: central nervous system development; endocytosis; signal transduction
Research Articles on SH3GL3
Similar Products
Product Notes
The SH3GL3 sh3gl3 (Catalog #AAA6004499) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SH3GL3 (Endophilin-A3, EEN-B2, Endophilin-3, SH3 Domain Protein 2C, SH3 Domain-containing GRB2-like Protein 3, CNSA3, SH3D2C) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SH3GL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SH3GL3 sh3gl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSVAGLKKQF HKASQLFSEK ISGAEGTKLD DEFLDMERKI DVTNKVVAEI LSKTTEYLQP NPAYRAKLGM LNTVSKIRGQ VKTTGYPQTE GLLGDCMLKY GKELGEDSTF GNALIEVGES MKLMAEVKDS LDINVKQTFI DPLQLLQDKD LKEIGHHLKK LEGRRLDYDY KKKRVGKIPD EEVRQAVEKF EESKELAERS MFNFLENDVE QVSQLAVFIE AALDYHRQST EILQELQSKL QMRISAASSV PRREYKPRPV KRSSSELNGV STTSVVKTTA YSRLEPAD. It is sometimes possible for the material contained within the vial of "SH3GL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
