Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SH2D2ASample Tissue: Human HepG2 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SH2D2A Polyclonal Antibody | anti-SH2D2A antibody

SH2D2A Antibody - middle region

Gene Names
SH2D2A; SCAP; TSAD; VRAP; F2771
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SH2D2A; Polyclonal Antibody; SH2D2A Antibody - middle region; anti-SH2D2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HYTAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQDPNPQYSP
Sequence Length
389
Applicable Applications for anti-SH2D2A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SH2D2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SH2D2ASample Tissue: Human HepG2 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SH2D2ASample Tissue: Human HepG2 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SH2D2A antibody
This gene encodes an adaptor protein thought to function in T-cell signal transduction. A related protein in mouse is responsible for the activation of lymphocyte-specific protein-tyrosine kinase and functions in downstream signaling. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-SH2D2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
SH2 domain-containing protein 2A isoform 3
NCBI Official Synonym Full Names
SH2 domain containing 2A
NCBI Official Symbol
SH2D2A
NCBI Official Synonym Symbols
SCAP; TSAD; VRAP; F2771
NCBI Protein Information
SH2 domain-containing protein 2A
UniProt Protein Name
SH2 domain-containing protein 2A
UniProt Gene Name
SH2D2A
UniProt Synonym Gene Names
SCAP; TSAD; VRAP; TSAd
UniProt Entry Name
SH22A_HUMAN

NCBI Description

This gene encodes an adaptor protein thought to function in T-cell signal transduction. A related protein in mouse is responsible for the activation of lymphocyte-specific protein-tyrosine kinase and functions in downstream signaling. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Uniprot Description

TSAd: an adaptor protein that may facilitate and regulate interaction of KDR with effector proteins important to endothelial cell survival and proliferation. May play a role in the CD4-p56- LCK-dependent signal transduction pathway in T cells. Could also play an important role in normal and pathological angiogenesis.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: cytoplasm; cytosol

Molecular Function: protein binding; SH3/SH2 adaptor activity; SH3 domain binding

Biological Process: cell proliferation; positive regulation of signal transduction; angiogenesis; signal transduction; cell differentiation; vascular endothelial growth factor receptor signaling pathway

Research Articles on SH2D2A

Similar Products

Product Notes

The SH2D2A sh2d2a (Catalog #AAA3220830) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SH2D2A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SH2D2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SH2D2A sh2d2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HYTAHPLSPY GETLTEPLAR QTPEPAGLSL RTEESNFGSK SQDPNPQYSP. It is sometimes possible for the material contained within the vial of "SH2D2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.