Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SGMS1Sample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

Rabbit SGMS1 Polyclonal Antibody | anti-SGMS1 antibody

SGMS1 antibody - middle region

Gene Names
SGMS1; MOB; MOB1; SMS1; TMEM23; hmob33
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SGMS1; Polyclonal Antibody; SGMS1 antibody - middle region; anti-SGMS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI
Sequence Length
413
Applicable Applications for anti-SGMS1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SGMS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SGMS1Sample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SGMS1Sample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-SGMS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateSGMS1 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-SGMS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateSGMS1 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-SGMS1 antibody
This is a rabbit polyclonal antibody against SGMS1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SGMS1 is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain.The protein encoded by this gene is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-SGMS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
phosphatidylcholine:ceramide cholinephosphotransferase 1
NCBI Official Synonym Full Names
sphingomyelin synthase 1
NCBI Official Symbol
SGMS1
NCBI Official Synonym Symbols
MOB; MOB1; SMS1; TMEM23; hmob33
NCBI Protein Information
phosphatidylcholine:ceramide cholinephosphotransferase 1
UniProt Protein Name
Phosphatidylcholine:ceramide cholinephosphotransferase 1
UniProt Gene Name
SGMS1
UniProt Synonym Gene Names
MOB; SMS1; TMEM23; Protein Mob
UniProt Entry Name
SMS1_HUMAN

NCBI Description

The protein encoded by this gene is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain. [provided by RefSeq, Jul 2008]

Uniprot Description

TMEM23: Sphingomyelin synthases synthesize the sphingolipid, sphingomyelin, through transfer of the phosphatidyl head group, phosphatidylcholine, on to the primary hydroxyl of ceramide. The reaction is bidirectional depending on the respective levels of the sphingolipid and ceramide. Golgi apparatus SMS1 directly and specifically recognizes the choline head group on the substrate, requiring two fatty chains on the choline-P donor molecule in order to be recognized efficiently as a substrate. Major form in macrophages. Required for cell growth in certain cell types such as HeLa cells. Suppresses BAX-mediated apoptosis and also prevents cell death in response to stimuli such as hydrogen peroxide, osmotic stress, elevated temperature and exogenously supplied sphingolipids. May protect against cell death by reversing the stress-inducible increase in levels of proapoptotic ceramide. Belongs to the sphingomyelin synthase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; EC 2.7.8.27; Membrane protein, integral; Lipid Metabolism - sphingolipid; Transferase

Chromosomal Location of Human Ortholog: 10q11.2

Cellular Component: Golgi membrane; membrane; endoplasmic reticulum; Golgi trans cisterna; plasma membrane; integral to Golgi membrane; nucleus

Molecular Function: sphingomyelin synthase activity; kinase activity; ceramide cholinephosphotransferase activity

Biological Process: sphingolipid metabolic process; sphingolipid biosynthetic process; apoptosis; cell growth; sphingomyelin biosynthetic process; inflammatory response; phosphorylation

Research Articles on SGMS1

Similar Products

Product Notes

The SGMS1 sgms1 (Catalog #AAA3212242) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SGMS1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SGMS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SGMS1 sgms1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SCFVLTTVMI SVVHERVPPK EVQPPLPDTF FDHFNRVQWA FSICEINGMI. It is sometimes possible for the material contained within the vial of "SGMS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.