Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SFTPD expression in transfected 293T cell line by SFTPD MaxPab polyclonal antibody.Lane 1: SFTPD transfected lysate(37.70 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human SFTPD Polyclonal Antibody | anti-SFTPD antibody

SFTPD (Surfactant Protein D, COLEC7, PSP-D, SFTP4, SP-D) (APC)

Gene Names
SFTPD; SP-D; PSP-D; SFTP4; COLEC7
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
SFTPD; Polyclonal Antibody; SFTPD (Surfactant Protein D; COLEC7; PSP-D; SFTP4; SP-D) (APC); Surfactant Protein D; SP-D; anti-SFTPD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SFTPD.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SFTPD antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SFTPD (AAH22318.1, 1aa-375aa) full-length human protein.
Immunogen Sequence
MLLFLLSALVLLTQPLGYLEAGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SFTPD expression in transfected 293T cell line by SFTPD MaxPab polyclonal antibody.Lane 1: SFTPD transfected lysate(37.70 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SFTPD expression in transfected 293T cell line by SFTPD MaxPab polyclonal antibody.Lane 1: SFTPD transfected lysate(37.70 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-SFTPD antibody
Rabbit polyclonal antibody raised against a full-length human SFTPD protein.
Product Categories/Family for anti-SFTPD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
37,728 Da
NCBI Official Full Name
Surfactant protein D
NCBI Official Synonym Full Names
surfactant protein D
NCBI Official Symbol
SFTPD
NCBI Official Synonym Symbols
SP-D; PSP-D; SFTP4; COLEC7
NCBI Protein Information
pulmonary surfactant-associated protein D; collectin 7; collectin-7; lung surfactant protein D; pulmonary surfactant apoprotein; surfactant, pulmonary-associated protein D; surfactant-associated protein, pulmonary 4
UniProt Protein Name
Pulmonary surfactant-associated protein D
UniProt Gene Name
SFTPD
UniProt Synonym Gene Names
COLEC7; PSPD; SFTP4; PSP-D; SP-D
UniProt Entry Name
SFTPD_HUMAN

Uniprot Description

SFTPD: Contributes to the lung's defense against inhaled microorganisms. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties. Belongs to the SFTPD family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 10q22.2-q23.1

Cellular Component: extracellular space; proteinaceous extracellular matrix; collagen; lysosome; endocytic vesicle; extracellular region

Molecular Function: protein binding; carbohydrate binding

Biological Process: receptor-mediated endocytosis; negative regulation of T cell proliferation; positive regulation of phagocytosis; negative regulation of interleukin-2 biosynthetic process; defense response to bacterium; innate immune response; respiratory gaseous exchange; surfactant homeostasis; macrophage chemotaxis; alveolus development; regulation of cytokine production

Similar Products

Product Notes

The SFTPD sftpd (Catalog #AAA6451653) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SFTPD (Surfactant Protein D, COLEC7, PSP-D, SFTP4, SP-D) (APC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SFTPD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SFTPD sftpd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SFTPD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.