Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Rabbit SF1 Polyclonal Antibody | anti-SF1 antibody

SF1 antibody - N-terminal region

Gene Names
SF1; BBP; MBBP; ZFM1; ZNF162; D11S636; ZCCHC25
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SF1; Polyclonal Antibody; SF1 antibody - N-terminal region; anti-SF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERA
Sequence Length
639
Applicable Applications for anti-SF1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-SF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-SF1 antibody
This is a rabbit polyclonal antibody against SF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SF1 contains 1 CCHC-type zinc finger and 1 KH domain. SF1 is Necessary for the ATP-dependent first step of spliceosome assembly. It binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. SF1 may act as transcription repressor.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
splicing factor 1 isoform 1
NCBI Official Synonym Full Names
splicing factor 1
NCBI Official Symbol
SF1
NCBI Official Synonym Symbols
BBP; MBBP; ZFM1; ZNF162; D11S636; ZCCHC25
NCBI Protein Information
splicing factor 1
UniProt Protein Name
Splicing factor 1
Protein Family
UniProt Gene Name
SF1
UniProt Synonym Gene Names
ZFM1; ZNF162; BBP; mBBP
UniProt Entry Name
SF01_HUMAN

NCBI Description

This gene encodes a nuclear pre-mRNA splicing factor. The encoded protein specifically recognizes the intron branch point sequence at the 3' splice site, together with the large subunit of U2 auxiliary factor (U2AF), and is required for the early stages of spliceosome assembly. It also plays a role in nuclear pre-mRNA retention and transcriptional repression. The encoded protein contains an N-terminal U2AF ligand motif, a central hnRNP K homology motif and quaking 2 region which bind a key branch-site adenosine within the branch point sequence, a zinc knuckles domain, and a C-terminal proline-rich domain. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016]

Uniprot Description

SF1: a splicing factor necessary for the ATP-dependent first step of spliceosome assembly. Binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. May act as transcription repressor. Phosphorylation of SF1 by cGMP-dependent protein kinase regulates spliceosome assembly. Binds U2AF2. Interacts with U1 snRNA. Binds EWSR1, FUS and TAF15. Six alternatively spliced isoforms have been described.

Protein type: RNA splicing; RNA-binding; Transcription, coactivator/corepressor; Spliceosome

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: nucleoplasm; spliceosome; ribosome; nucleus

Molecular Function: zinc ion binding; RNA binding; transcription corepressor activity

Biological Process: nuclear mRNA splicing, via spliceosome; nuclear mRNA 3'-splice site recognition; Leydig cell differentiation; transcription, DNA-dependent; regulation of transcription, DNA-dependent; negative regulation of smooth muscle cell proliferation; male sex determination; spliceosome assembly; regulation of steroid biosynthetic process

Research Articles on SF1

Similar Products

Product Notes

The SF1 sf1 (Catalog #AAA3204115) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SF1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SF1 sf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ATGANATPLD FPSKKRKRSR WNQDTMEQKT VIPGMPTVIP PGLTREQERA. It is sometimes possible for the material contained within the vial of "SF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.