Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SETD7 Antibody Titration: 5.0ug/mlPositive Control: Human Pancreas)

Rabbit SETD7 Polyclonal Antibody | anti-SETD7 antibody

SETD7 antibody - C-terminal region

Gene Names
SETD7; KMT7; SET7; SET9; SET7/9
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
SETD7; Polyclonal Antibody; SETD7 antibody - C-terminal region; anti-SETD7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF
Sequence Length
366
Applicable Applications for anti-SETD7 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SETD7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SETD7 Antibody Titration: 5.0ug/mlPositive Control: Human Pancreas)

Western Blot (WB) (WB Suggested Anti-SETD7 Antibody Titration: 5.0ug/mlPositive Control: Human Pancreas)
Related Product Information for anti-SETD7 antibody
This is a rabbit polyclonal antibody against SETD7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SETD7 is a histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. It plays a central role in the transcriptional activation of genes such as collagenase or insulin. It is recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. It has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
histone-lysine N-methyltransferase SETD7 isoform 1
NCBI Official Synonym Full Names
SET domain containing 7, histone lysine methyltransferase
NCBI Official Symbol
SETD7
NCBI Official Synonym Symbols
KMT7; SET7; SET9; SET7/9
NCBI Protein Information
histone-lysine N-methyltransferase SETD7
UniProt Protein Name
Histone-lysine N-methyltransferase SETD7
UniProt Gene Name
SETD7
UniProt Synonym Gene Names
KIAA1717; KMT7; SET7; SET9; H3-K4-HMTase SETD7
UniProt Entry Name
SETD7_HUMAN

Uniprot Description

SETD7: Histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in the transcriptional activation of genes such as collagenase or insulin. Recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. Has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins. Monomethylates 'Lys-189' of TAF10, leading to increase the affinity of TAF10 for RNA polymerase II. Monomethylates 'Lys-372' of p53/TP53, stabilizing p53/TP53 and increasing p53/TP53-mediated transcriptional activation. Interacts with IPF1/PDX-1. Widely expressed. Expressed in pancreatic islets. Belongs to the histone-lysine methyltransferase family. SET7 subfamily.

Protein type: Amino Acid Metabolism - lysine degradation; EC 2.1.1.43; Methyltransferase, protein lysine; Methyltransferase

Chromosomal Location of Human Ortholog: 4q28

Cellular Component: nucleoplasm; nucleolus; chromosome

Molecular Function: protein binding; p53 binding; protein-lysine N-methyltransferase activity; histone-lysine N-methyltransferase activity

Biological Process: establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; regulation of transcription, DNA-dependent; peptidyl-lysine di-methylation; peptidyl-lysine mono-methylation; chromatin modification; response to DNA damage stimulus

Research Articles on SETD7

Similar Products

Product Notes

The SETD7 setd7 (Catalog #AAA3209251) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SETD7 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SETD7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SETD7 setd7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PRFGPIKCIR TLRAVEADEE LTVAYGYDHS PPGKSGPEAP EWYQVELKAF. It is sometimes possible for the material contained within the vial of "SETD7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.