Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SERPINF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)

Rabbit SERPINF2 Polyclonal Antibody | anti-SERPINF2 antibody

SERPINF2 antibody - N-terminal region

Gene Names
SERPINF2; AAP; API; PLI; A2AP; ALPHA-2-PI
Reactivity
Cow, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SERPINF2; Polyclonal Antibody; SERPINF2 antibody - N-terminal region; anti-SERPINF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSH
Sequence Length
491
Applicable Applications for anti-SERPINF2 antibody
Western Blot (WB)
Homology
Cow: 91%; Horse: 100%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SERPINF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-SERPINF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)
Related Product Information for anti-SERPINF2 antibody
This is a rabbit polyclonal antibody against SERPINF2. It was validated on Western Blot

Target Description: This gene encodes a member of the serpin family of serine protease inhibitors. The protein is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in this gene result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
alpha-2-antiplasmin isoform a
NCBI Official Synonym Full Names
serpin family F member 2
NCBI Official Symbol
SERPINF2
NCBI Official Synonym Symbols
AAP; API; PLI; A2AP; ALPHA-2-PI
NCBI Protein Information
alpha-2-antiplasmin
UniProt Protein Name
Alpha-2-antiplasmin
Protein Family
UniProt Gene Name
SERPINF2
UniProt Synonym Gene Names
AAP; PLI; Alpha-2-AP; Alpha-2-PI
UniProt Entry Name
A2AP_HUMAN

NCBI Description

This gene encodes a member of the serpin family of serine protease inhibitors. The protein is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in this gene result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

Uniprot Description

SERPINF2: Serine protease inhibitor. The major targets of this inhibitor are plasmin and trypsin, but it also inactivates matriptase-3/TMPRSS7 and chymotrypsin. Defects in SERPINF2 are the cause of alpha-2-plasmin inhibitor deficiency (APLID). APLID is an autosomal recessive disorder resulting in severe hemorrhagic diathesis. Belongs to the serpin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: extracellular space; cell surface; fibrinogen complex; extracellular region

Molecular Function: serine-type endopeptidase inhibitor activity; protein binding; protein homodimerization activity; protease binding; endopeptidase inhibitor activity

Biological Process: platelet activation; collagen fibril organization; positive regulation of smooth muscle cell proliferation; positive regulation of collagen biosynthetic process; positive regulation of JNK cascade; response to organic substance; fibrinolysis; platelet degranulation; negative regulation of fibrinolysis; renin-angiotensin regulation of blood vessel size; positive regulation of stress fiber formation; acute-phase response; blood vessel morphogenesis; positive regulation of transcription from RNA polymerase II promoter; positive regulation of cell differentiation; blood coagulation

Disease: Alpha-2-plasmin Inhibitor Deficiency

Research Articles on SERPINF2

Similar Products

Product Notes

The SERPINF2 serpinf2 (Catalog #AAA3214225) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINF2 antibody - N-terminal region reacts with Cow, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SERPINF2 serpinf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CSRDPTPEQT HRLARAMMAF TADLFSLVAQ TSTCPNLILS PLSVALALSH. It is sometimes possible for the material contained within the vial of "SERPINF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.