Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Serpinc1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)

Rabbit Serpinc1 Polyclonal Antibody | anti-SERPINC1 antibody

Serpinc1 antibody - C-terminal region

Gene Names
Serpinc1; At3; At-3; ATIII; AI114908
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Serpinc1; Polyclonal Antibody; Serpinc1 antibody - C-terminal region; anti-SERPINC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV
Sequence Length
465
Applicable Applications for anti-SERPINC1 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Serpinc1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)

Western Blot (WB) (WB Suggested Anti-Serpinc1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)
Related Product Information for anti-SERPINC1 antibody
This is a rabbit polyclonal antibody against Serpinc1. It was validated on Western Blot

Target Description: Serpinc1 is the most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin.
Product Categories/Family for anti-SERPINC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
antithrombin-III
NCBI Official Synonym Full Names
serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1
NCBI Official Symbol
Serpinc1
NCBI Official Synonym Symbols
At3; At-3; ATIII; AI114908
NCBI Protein Information
antithrombin-III
UniProt Protein Name
Antithrombin-III
Protein Family
UniProt Gene Name
Serpinc1
UniProt Synonym Gene Names
At3; ATIII
UniProt Entry Name
ANT3_MOUSE

Uniprot Description

SERPINC1: Most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin, matriptase-3/TMPRSS7, as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin. Defects in SERPINC1 are the cause of antithrombin III deficiency (AT3D). AT3D is an important risk factor for hereditary thrombophilia, a hemostatic disorder characterized by a tendency to recurrent thrombosis. AT3D is classified into 4 types. Type I: characterized by a 50% decrease in antigenic and functional levels. Type II: has defects affecting the thrombin- binding domain. Type III: alteration of the heparin-binding domain. Plasma AT-III antigen levels are normal in type II and III. Type IV: consists of miscellaneous group of unclassifiable mutations. Belongs to the serpin family.

Protein type: Secreted; Inhibitor; Secreted, signal peptide

Cellular Component: extracellular space; extracellular region

Molecular Function: heparin binding; serine-type endopeptidase inhibitor activity; protease binding; protease inhibitor activity

Biological Process: hemostasis; negative regulation of inflammatory response; negative regulation of peptidase activity; blood coagulation; response to nutrient

Research Articles on SERPINC1

Similar Products

Product Notes

The SERPINC1 serpinc1 (Catalog #AAA3205824) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Serpinc1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Serpinc1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SERPINC1 serpinc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAASTSVVIT GRSLNPNRVT FKANRPFLVL IREVALNTII FMGRVANPCV. It is sometimes possible for the material contained within the vial of "Serpinc1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.