Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SERPINB5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Rabbit anti-Human, Mouse SERPINB5 Polyclonal Antibody | anti-SERPINB5 antibody
SERPINB5 Polyclonal Antibody
Gene Names
SERPINB5; PI5; maspin
Reactivity
Human, Mouse
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purification
Synonyms
SERPINB5; Polyclonal Antibody; SERPINB5 Polyclonal Antibody; maspin; PI5; anti-SERPINB5 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
EKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNK
Sequence Length
375
Applicable Applications for anti-SERPINB5 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human SERPINB5
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Secreted, extracellular space
Positive Samples
HT-29, NIH/3T3
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SERPINB5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using SERPINB5 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human stomach using SERPINB5 Antibody at dilution of 1:200 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human stomach using SERPINB5 Antibody at dilution of 1:200 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human rectum using SERPINB5 Antibody at dilution of 1:200 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human rectum using SERPINB5 Antibody at dilution of 1:200 (40x lens).)
Product Categories/Family for anti-SERPINB5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 25kDa; 42kDa
Observed: 43kDa
Observed: 43kDa
NCBI Official Full Name
serpin B5
NCBI Official Synonym Full Names
serpin family B member 5
NCBI Official Symbol
SERPINB5
NCBI Official Synonym Symbols
PI5; maspin
NCBI Protein Information
serpin B5
UniProt Protein Name
Serpin B5
Protein Family
UniProt Gene Name
SERPINB5
UniProt Synonym Gene Names
PI5; PI-5
Uniprot Description
Tumor suppressor. It blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
Research Articles on SERPINB5
Similar Products
Product Notes
The SERPINB5 serpinb5 (Catalog #AAA9134052) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINB5 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINB5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the SERPINB5 serpinb5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EKEPLGNVLF SPICLSTSLS LAQVGAKGDT ANEIGQVLHF ENVKDVPFGF QTVTSDVNKL SSFYSLKLIK RLYVDKSLNL STEFISSTKR PYAKELETVD FKDKLEETKG QINNSIKDLT DGHFENILAD NSVNDQTKIL VVNAAYFVGK WMKKFSESET KECPFRVNK. It is sometimes possible for the material contained within the vial of "SERPINB5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
