Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SERPINB4 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit SERPINB4 Polyclonal Antibody | anti-SERPINB4 antibody

SERPINB4 antibody - N-terminal region

Gene Names
SERPINB4; PI11; SCCA1; SCCA2; LEUPIN; SCCA-2
Reactivity
Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SERPINB4; Polyclonal Antibody; SERPINB4 antibody - N-terminal region; anti-SERPINB4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKAATYHVDRSGNVHHQ
Sequence Length
390
Applicable Applications for anti-SERPINB4 antibody
Western Blot (WB)
Homology
Human: 100%; Rabbit: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINB4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SERPINB4 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-SERPINB4 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-SERPINB4 antibody
This is a rabbit polyclonal antibody against SERPINB4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SERPINB4 may act as a protease inhibitor to modulate the host immune response against tumor cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45
NCBI Official Full Name
serpin B4 isoform 1
NCBI Official Synonym Full Names
serpin family B member 4
NCBI Official Symbol
SERPINB4
NCBI Official Synonym Symbols
PI11; SCCA1; SCCA2; LEUPIN; SCCA-2
NCBI Protein Information
serpin B4
UniProt Protein Name
Serpin B4
Protein Family
UniProt Gene Name
SERPINB4
UniProt Synonym Gene Names
PI11; SCCA2; PI-11; SCCA-2
UniProt Entry Name
SPB4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein is highly expressed in many tumor cells and can inactivate granzyme M, an enzyme that kills tumor cells. This protein, along with serpin B3, can be processed into smaller fragments that aggregate to form an autoantigen in psoriasis, probably by causing chronic inflammation. [provided by RefSeq, Jan 2017]

Uniprot Description

SERPINB4: May act as a protease inhibitor to modulate the host immune response against tumor cells. Belongs to the serpin family. Ov-serpin subfamily.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 18q21.3

Cellular Component: extracellular space; cytoplasm; intracellular

Molecular Function: serine-type endopeptidase inhibitor activity; enzyme binding; protease binding

Biological Process: regulation of proteolysis; negative regulation of peptidase activity; protection from natural killer cell mediated cytotoxicity

Research Articles on SERPINB4

Similar Products

Product Notes

The SERPINB4 serpinb4 (Catalog #AAA3206185) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINB4 antibody - N-terminal region reacts with Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINB4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SERPINB4 serpinb4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TSALGMVLLG AKDNTAQQIS KVLHFDQVTE NTTEKAATYH VDRSGNVHHQ. It is sometimes possible for the material contained within the vial of "SERPINB4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.