Western Blot (WB)
(Western blot analysis of extracts of Human serum, using SERPINA9 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Rabbit anti-Human SERPINA9 Polyclonal Antibody | anti-SERPINA9 antibody
SERPINA9 Rabbit pAb
Gene Names
SERPINA9; GCET1; SERPINA11; SERPINA11b
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
SERPINA9; Polyclonal Antibody; SERPINA9 Rabbit pAb; GCET1; SERPINA11; SERPINA11b; serpin A9; anti-SERPINA9 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
TQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQ
Applicable Applications for anti-SERPINA9 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 110-210 of human SERPINA9 (NP_783866.2).
Cellular Location
Cytoplasm, Membrane, Secreted, Single-pass type II membrane protein
Positive Samples
Human serum
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of Human serum, using SERPINA9 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Western Blot (WB)
(Western blot analysis of extracts of Human serum, using SERPINA9 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46,557 Da
NCBI Official Full Name
serpin A9 isoform D
NCBI Official Synonym Full Names
serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9
NCBI Official Symbol
SERPINA9
NCBI Official Synonym Symbols
GCET1; SERPINA11; SERPINA11b
NCBI Protein Information
serpin A9; centerin; serine proteinase inhibitor A11; germinal center B-cell-expressed transcript 1 protein; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9
UniProt Protein Name
Serpin A9
Protein Family
UniProt Gene Name
SERPINA9
UniProt Synonym Gene Names
GCET1; SERPINA11
UniProt Entry Name
SPA9_HUMAN
Uniprot Description
SERPINA9: Protease inhibitor that inhibits trypsin and trypsin- like serine proteases (in vitro). Inhibits plasmin and thrombin with lower efficiency (in vitro). Belongs to the serpin family. 7 isoforms of the human protein are produced by alternative splicing.
Protein type: Inhibitor; Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 14q32.13
Cellular Component: extracellular space; membrane; cytoplasm
Molecular Function: serine-type endopeptidase inhibitor activity
Research Articles on SERPINA9
Similar Products
Product Notes
The SERPINA9 serpina9 (Catalog #AAA9142202) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SERPINA9 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SERPINA9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the SERPINA9 serpina9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TQILQGLGFN LTHTPESAIH QGFQHLVHSL TVPSKDLTLK MGSALFVKKE LQLQANFLGN VKRLYEAEVF STDFSNPSIA QARINSHVKK KTQGKVVDII Q. It is sometimes possible for the material contained within the vial of "SERPINA9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
