Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SEPT5 polyclonal antibody. Western Blot analysis of SEPT5 expression in human liver.)

Mouse anti-Human SEPT5 Polyclonal Antibody | anti-SEPT5 antibody

SEPT5 (Septin-5, Cell Division Control-related Protein 1, CDCrel-1, Peanut-like Protein 1, PNUTL1)

Gene Names
SEPT5; H5; CDCREL; PNUTL1; CDCREL1; CDCREL-1; HCDCREL-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SEPT5; Polyclonal Antibody; SEPT5 (Septin-5; Cell Division Control-related Protein 1; CDCrel-1; Peanut-like Protein 1; PNUTL1); Anti -SEPT5 (Septin-5; anti-SEPT5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SEPT5.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
Applicable Applications for anti-SEPT5 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SEPT5, aa1-369 (NP_002679.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SEPT5 polyclonal antibody. Western Blot analysis of SEPT5 expression in human liver.)

Western Blot (WB) (SEPT5 polyclonal antibody. Western Blot analysis of SEPT5 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of SEPT5 expression in transfected 293T cell line by SEPT5 polyclonal antibody. Lane 1: SEPT5 transfected lysate (40.59kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SEPT5 expression in transfected 293T cell line by SEPT5 polyclonal antibody. Lane 1: SEPT5 transfected lysate (40.59kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SEPT5 antibody
Filament-forming cytoskeletal GTPase By similarity. May play a role in cytokinesis Potential. May play a role in platelet secretion.
Product Categories/Family for anti-SEPT5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,777 Da
NCBI Official Full Name
septin-5 isoform 2
NCBI Official Synonym Full Names
septin 5
NCBI Official Symbol
SEPT5
NCBI Official Synonym Symbols
H5; CDCREL; PNUTL1; CDCREL1; CDCREL-1; HCDCREL-1
NCBI Protein Information
septin-5; peanut-like 1; platelet glycoprotein Ib beta chain; cell division control related protein 1
UniProt Protein Name
Septin-5
UniProt Gene Name
SEPT5
UniProt Synonym Gene Names
PNUTL1; CDCrel-1
UniProt Entry Name
SEPT5_HUMAN

NCBI Description

This gene is a member of the septin gene family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is mapped to 22q11, the region frequently deleted in DiGeorge and velocardiofacial syndromes. A translocation involving the MLL gene and this gene has also been reported in patients with acute myeloid leukemia. Alternative splicing results in multiple transcript variants. The presence of a non-consensus polyA signal (AACAAT) in this gene also results in read-through transcription into the downstream neighboring gene (GP1BB; platelet glycoprotein Ib), whereby larger, non-coding transcripts are produced. [provided by RefSeq, Dec 2010]

Uniprot Description

SEPT5: Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential). May play a role in platelet secretion. Belongs to the septin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle; Hydrolase; Cell cycle regulation; Cytoskeletal

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: synaptic vesicle; cytoskeleton; plasma membrane; terminal button; cell cortex

Molecular Function: GTPase activity; protein binding; GTP binding; structural molecule activity

Biological Process: regulation of exocytosis; metabolic process; cytokinesis; synaptic vesicle targeting

Research Articles on SEPT5

Similar Products

Product Notes

The SEPT5 sept5 (Catalog #AAA6001543) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SEPT5 (Septin-5, Cell Division Control-related Protein 1, CDCrel-1, Peanut-like Protein 1, PNUTL1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SEPT5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SEPT5 sept5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSSNVPADMI NLRLILVSGK TKEFLFSPND SASDIAKHVY DNWPMDWEEE QVSSPNILRL IYQGRFLHGN VTLGALKLPF GKTTVMHLVA RETLPEPNSQ GQRNREKTGE SNCCVIL. It is sometimes possible for the material contained within the vial of "SEPT5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.