Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SENP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of SENP3 expression in HepG2.)

Rabbit anti-Human SENP3 Polyclonal Antibody | anti-SENP3 antibody

SENP3 (SUMO1/sentrin/SMT3 Specific Peptidase 3, DKFZp586K0919, DKFZp762A152, SMT3IP1, SSP3) (FITC)

Gene Names
SENP3; SSP3; Ulp1; SMT3IP1
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
SENP3; Polyclonal Antibody; SENP3 (SUMO1/sentrin/SMT3 Specific Peptidase 3; DKFZp586K0919; DKFZp762A152; SMT3IP1; SSP3) (FITC); SUMO1/sentrin/SMT3 Specific Peptidase 3; SSP3; anti-SENP3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SENP3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-SENP3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SENP3 (NP_056485.2, 1aa-574aa) full-length human protein.
Immunogen Sequence
MKETIQGTGSWGPEPPGPGIPPAYSSPRRERLRWPPPPKPRLKSGGGFGPDPGSGTTVPARRLPVPRPSFDASASEEEEEEEEEEDEDEEEEVAAWRLPPRWSQLGTSQRPRPSRPTHRKTCSQRRRRAMRAFRMLLYSKSTSLTFHWKLWGRHRGRRRGLAHPKNHLSPQQGGATPQVPSPCCRFDSPRGPPPPRLGLLGALMAEDGVRGSPPVPSGPPMEEDGLRWTPKSPLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGDHVAQELFQGSDLGMAEEAERPGEKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEKVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

Western Blot (WB)

(SENP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of SENP3 expression in HepG2.)

Western Blot (WB) (SENP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of SENP3 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of SENP3 expression in transfected 293T cell line by SENP3 MaxPab polyclonal antibody.Lane 1: SENP3 transfected lysate(65.00 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SENP3 expression in transfected 293T cell line by SENP3 MaxPab polyclonal antibody.Lane 1: SENP3 transfected lysate(65.00 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-SENP3 antibody
The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP3, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates (Di Bacco et al., 2006 [PubMed 16738315]).[supplied by OMIM]
Product Categories/Family for anti-SENP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65,010 Da
NCBI Official Full Name
sentrin-specific protease 3
NCBI Official Synonym Full Names
SUMO1/sentrin/SMT3 specific peptidase 3
NCBI Official Symbol
SENP3
NCBI Official Synonym Symbols
SSP3; Ulp1; SMT3IP1
NCBI Protein Information
sentrin-specific protease 3; SUMO-1-specific protease 3; sentrin/SUMO-specific protease 3
UniProt Protein Name
Sentrin-specific protease 3
Protein Family
UniProt Gene Name
SENP3
UniProt Synonym Gene Names
SSP3; SUSP3
UniProt Entry Name
SENP3_HUMAN

NCBI Description

The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP3, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates (Di Bacco et al., 2006 [PubMed 16738315]).[supplied by OMIM, Jun 2009]

Uniprot Description

SENP3: Protease that releases SUMO2 and SUMO3 monomers from sumoylated substrates, but has only weak activity against SUMO1 conjugates. Deconjugates SUMO2 from MEF2D, which increases its transcriptional activation capability. Deconjugates SUMO2 and SUMO3 from CDCA8. Redox sensor that, when redistributed into nucleoplasm, can act as an effector to enhance HIF1A transcriptional activity by desumoylating EP300. Required for rRNA processing through deconjugation of SUMO2 and SUMO3 from nucleophosmin, NPM1. Binds to SUMO1 and SUMO3. Component of some MLL1/MLL complex, at least composed of the core components MLL, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components C17orf49, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts with EP300, NPM1 and CDCA8. On oxidative stress, SENP3 degradation is blocked by inhibition of its ubiquitination, which stabilizes it as it accumulates in the nucleoplasm. Belongs to the peptidase C48 family.

Protein type: EC 3.4.22.68; Ubiquitin-specific protease; Nucleolus; Protease

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; cysteine-type peptidase activity

Biological Process: proteolysis

Research Articles on SENP3

Similar Products

Product Notes

The SENP3 senp3 (Catalog #AAA6451633) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SENP3 (SUMO1/sentrin/SMT3 Specific Peptidase 3, DKFZp586K0919, DKFZp762A152, SMT3IP1, SSP3) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SENP3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SENP3 senp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SENP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.