Rabbit anti-Human SENP3 Polyclonal Antibody | anti-SENP3 antibody

SENP3 (SUMO1/sentrin/SMT3 Specific Peptidase 3, DKFZp586K0919, DKFZp762A152, SMT3IP1, SSP3) (FITC)

Cat. Num. AAA6451633

• Gene Names: SENP3; SSP3; Ulp1; SMT3IP1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified
• Synonyms: SENP3; Polyclonal Antibody; SENP3 (SUMO1/sentrin/SMT3 Specific Peptidase 3; DKFZp586K0919; DKFZp762A152; SMT3IP1; SSP3) (FITC); SUMO1/sentrin/SMT3 Specific Peptidase 3; SSP3; anti-SENP3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SENP3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-SENP3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SENP3 (NP_056485.2, 1aa-574aa) full-length human protein.
• Immunogen Sequence: MKETIQGTGSWGPEPPGPGIPPAYSSPRRERLRWPPPPKPRLKSGGGFGPDPGSGTTVPARRLPVPRPSFDASASEEEEEEEEEEDEDEEEEVAAWRLPPRWSQLGTSQRPRPSRPTHRKTCSQRRRRAMRAFRMLLYSKSTSLTFHWKLWGRHRGRRRGLAHPKNHLSPQQGGATPQVPSPCCRFDSPRGPPPPRLGLLGALMAEDGVRGSPPVPSGPPMEEDGLRWTPKSPLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGDHVAQELFQGSDLGMAEEAERPGEKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEKVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

Western Blot (WB)

(SENP3 MaxPab rabbit polyclonal antibody. Western Blot analysis of SENP3 expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of SENP3 expression in transfected 293T cell line by SENP3 MaxPab polyclonal antibody.Lane 1: SENP3 transfected lysate(65.00 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-SENP3 antibody

The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP3, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates (Di Bacco et al., 2006 [PubMed 16738315]).[supplied by OMIM]

Product Categories/Family for anti-SENP3 antibody

Antibodies; Ubiquitin

NCBI and Uniprot Product Information

• NCBI GI #: 21361499
• NCBI GeneID: 26168
• NCBI Accession #: NP_056485.2
• NCBI GenBank Nucleotide #: NM_015670.5
• UniProt Accession #: Q9H4L4; Q66K15; Q86VS7; Q96PS4; Q9Y3W9
• Molecular Weight: 65,010 Da
• NCBI Official Full Name: sentrin-specific protease 3
• NCBI Official Synonym Full Names: SUMO1/sentrin/SMT3 specific peptidase 3
• NCBI Official Symbol: SENP3
• NCBI Official Synonym Symbols: SSP3; Ulp1; SMT3IP1
• NCBI Protein Information: sentrin-specific protease 3; SUMO-1-specific protease 3; sentrin/SUMO-specific protease 3
• UniProt Protein Name: Sentrin-specific protease 3
• Protein Family: Sentrin-specific protease
• UniProt Gene Name: SENP3
• UniProt Synonym Gene Names: SSP3; SUSP3
• UniProt Entry Name: SENP3_HUMAN

NCBI Description

The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP3, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates (Di Bacco et al., 2006 [PubMed 16738315]).[supplied by OMIM, Jun 2009]

Uniprot Description

SENP3: Protease that releases SUMO2 and SUMO3 monomers from sumoylated substrates, but has only weak activity against SUMO1 conjugates. Deconjugates SUMO2 from MEF2D, which increases its transcriptional activation capability. Deconjugates SUMO2 and SUMO3 from CDCA8. Redox sensor that, when redistributed into nucleoplasm, can act as an effector to enhance HIF1A transcriptional activity by desumoylating EP300. Required for rRNA processing through deconjugation of SUMO2 and SUMO3 from nucleophosmin, NPM1. Binds to SUMO1 and SUMO3. Component of some MLL1/MLL complex, at least composed of the core components MLL, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components C17orf49, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts with EP300, NPM1 and CDCA8. On oxidative stress, SENP3 degradation is blocked by inhibition of its ubiquitination, which stabilizes it as it accumulates in the nucleoplasm. Belongs to the peptidase C48 family.

Protein type: EC 3.4.22.68; Ubiquitin-specific protease; Nucleolus; Protease

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; cysteine-type peptidase activity

Biological Process: proteolysis