Western Blot (WB)
(Anti- SECTM1 Picoband antibody, MBS177755, Western blottingAll lanes: Anti SECTM1 (MBS177755) at 0.5ug/mlWB : HEPA Whole Cell Lysate at 40ugPredicted bind size: 23KDObserved bind size: 23KD )
anti-Mouse SECTM1 Polyclonal Antibody | anti-SECTM1 antibody
Anti-SECTM1 Antibody
Gene Names
Sectm1b; K12; Sectm1; 1810003C24Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
SECTM1; Polyclonal Antibody; Anti-SECTM1 Antibody; Secreted and transmembrane protein 1b; K12; K12 protein; Protein K-12; Protein K12; SCTM1_HUMAN; Secreted and transmembrane 1; Secreted and transmembrane protein 1; SECTM 1; Type 1a transmembrane protein; secreted and transmembrane 1; anti-SECTM1 antibody
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
212
Applicable Applications for anti-SECTM1 antibody
Western Blot (WB)
Application Notes
Western Blot
Concentration: 0.1-0.5ug/ml
Tested Species: Ms
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Concentration: 0.1-0.5ug/ml
Tested Species: Ms
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse SECTM1 (118-152aa KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Anti- SECTM1 Picoband antibody, MBS177755, Western blottingAll lanes: Anti SECTM1 (MBS177755) at 0.5ug/mlWB : HEPA Whole Cell Lysate at 40ugPredicted bind size: 23KDObserved bind size: 23KD )
Western Blot (WB)
(Anti- SECTM1 Picoband antibody, MBS177755, Western blottingAll lanes: Anti SECTM1 (MBS177755) at 0.5ug/mlWB : HEPA Whole Cell Lysate at 40ugPredicted bind size: 23KDObserved bind size: 23KD )
Related Product Information for anti-SECTM1 antibody
Description: Rabbit IgG polyclonal antibody for Secreted and transmembrane protein 1b(SECTM1) detection. Tested with WB in Mouse.
Background: SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
Background: SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
References
1. "Entrez Gene: SECTM1 secreted and transmembrane 1". 2. Lyman SD, Escobar S, Rousseau AM et al. (2000). "Identification of CD7 as a cognate of the human K12 (SECTM1) protein". J. Biol. Chem. 275 (5): 3431-7. 3. Slentz-Kesler KA, Hale LP, Kaufman RE (Apr 1998). "Identification and characterization of K12 (SECTM1), a novel human gene that encodes a Golgi-associated protein with transmembrane and secreted isoforms". Genomics47 (3): 327-40.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Secreted and transmembrane protein 1b
NCBI Official Synonym Full Names
secreted and transmembrane 1B
NCBI Official Symbol
Sectm1b
NCBI Official Synonym Symbols
K12; Sectm1; 1810003C24Rik
NCBI Protein Information
secreted and transmembrane protein 1b
UniProt Protein Name
Secreted and transmembrane protein 1b
Protein Family
UniProt Gene Name
Sectm1b
UniProt Synonym Gene Names
K12; Sectm1
UniProt Entry Name
SCT1B_MOUSE
Uniprot Description
Sectm1b: May be involved in thymocyte signaling. Belongs to the SECTM family.
Cellular Component: extracellular region; integral to membrane; integral to plasma membrane; membrane; plasma membrane
Molecular Function: signal transducer activity
Biological Process: immune response
Similar Products
Product Notes
The SECTM1 sectm1b (Catalog #AAA177755) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-SECTM1 Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SECTM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml Tested Species: Ms Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Researchers should empirically determine the suitability of the SECTM1 sectm1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SECTM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
