Rabbit anti-Human SDHB Polyclonal Antibody | anti-SDHB antibody

SDHB (Succinate Dehydrogenase [Ubiquinone] Iron-sulfur Subunit, Mitochondrial, Iron-sulfur Subunit of Complex II, Ip, SDH, SDH1, FLJ92337) (FITC)

Cat. Num. AAA6393489

• Gene Names: SDHB; IP; SDH; CWS2; PGL4; SDH1; SDH2; SDHIP
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SDHB; Polyclonal Antibody; SDHB (Succinate Dehydrogenase [Ubiquinone] Iron-sulfur Subunit; Mitochondrial; Iron-sulfur Subunit of Complex II; Ip; SDH; SDH1; FLJ92337) (FITC); anti-SDHB antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SDHB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
• Sequence Length: 1130

• Applicable Applications for anti-SDHB antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human SDHB, aa1-280 (NP_002991.2)
• Immunogen Sequence: MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SDHB rabbit polyclonal antibody. Western Blot analysis of SDHB expression in human kidney.)

Western Blot (WB)

(SDHB rabbit polyclonal antibody. Western Blot analysis of SDHB expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of SDHB expression in transfected 293T cell line by SDHB polyclonal antibody. Lane 1: SDHB transfected lysate (31.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-SDHB antibody

Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme.

Product Categories/Family for anti-SDHB antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 33871966
• NCBI GeneID: 6390
• NCBI Official Full Name: Homo sapiens succinate dehydrogenase complex, subunit B, iron sulfur (Ip), mRNA
• NCBI Official Synonym Full Names: succinate dehydrogenase complex iron sulfur subunit B
• NCBI Official Symbol: SDHB
• NCBI Official Synonym Symbols: IP; SDH; CWS2; PGL4; SDH1; SDH2; SDHIP
• NCBI Protein Information: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
• Protein Family: Succinate dehydrogenase

NCBI Description

Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis. [provided by RefSeq, Jul 2008]