Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget: SDHBPositive control (+): Human Liver (LI)Negative control (-): Human Lung (LU)Antibody concentration: 1ug/ml)

Rabbit SDHB Polyclonal Antibody | anti-SDHB antibody

SDHB antibody - middle region

Gene Names
SDHB; IP; SDH; CWS2; PGL4; SDH1; SDH2; SDHIP
Reactivity
Tested: Human
Predicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SDHB; Polyclonal Antibody; SDHB antibody - middle region; UBC; XRN1; ITGA4; TP53BP1; HNRNPUL2; PIGS; TIMM50; MRPL45; SLC25A22; MRPL40; MRPS5; IWS1; MRPS10; MRPL20; OCIAD1; TOMM7; NDUFB11; LAMTOR2; TMED2; TOMM40; RBM14; IQGAP1; UQCRFS1; SSBP1; SDHA; OXA1L; NDUFV2; NDUFS1; NDUFB9; NDUFB6; NDUFA10; NDUFA9; GSN; ATP; anti-SDHB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested: Human
Predicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE
Sequence Length
280
Applicable Applications for anti-SDHB antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SDHB
Protein Size (# AA)
280 amino acids
Protein Interactions
UBC; XRN1; ITGA4; TP53BP1; HNRNPUL2; PIGS; TIMM50; MRPL45; SLC25A22; MRPL40; MRPS5; IWS1; MRPS10; MRPL20; OCIAD1; TOMM7; NDUFB11; LAMTOR2; TMED2; TOMM40; RBM14; IQGAP1; UQCRFS1; SSBP1; SDHA; OXA1L; NDUFV2; NDUFS1; NDUFB9; NDUFB6; NDUFA10; NDUFA9; GSN; ATP
Blocking Peptide
For anti-SDHB (MBS3208809) antibody is Catalog # MBS3233774
Tissue Tool
Find tissues and cell lines supported by DNA array analysis to express SDHB
Sample Type Confirmation
SDHB is supported by BioGPS gene expression data to be expressed in Jurkat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget: SDHBPositive control (+): Human Liver (LI)Negative control (-): Human Lung (LU)Antibody concentration: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget: SDHBPositive control (+): Human Liver (LI)Negative control (-): Human Lung (LU)Antibody concentration: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GNASSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GNASSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: SDHBSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SDHBSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-SDHB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateSDHB is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-SDHB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateSDHB is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-SDHB antibody
This is a rabbit polyclonal antibody against SDHB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
succinate dehydrogenase
NCBI Official Synonym Full Names
succinate dehydrogenase complex iron sulfur subunit B
NCBI Official Symbol
SDHB
NCBI Official Synonym Symbols
IP; SDH; CWS2; PGL4; SDH1; SDH2; SDHIP
NCBI Protein Information
succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
UniProt Protein Name
Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
Protein Family
UniProt Gene Name
SDHB
UniProt Synonym Gene Names
SDH; SDH1; Ip
UniProt Entry Name
SDHB_HUMAN

NCBI Description

Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

SDHB: Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Defects in SDHB are a cause of susceptibility to pheochromocytoma (PCC). A catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent. Defects in SDHB are the cause of paragangliomas type 4 (PGL4). A neural crest tumor usually derived from the chromoreceptor tissue of a paraganglion. Paragangliomas are most commonly located in the head and neck region, specifically at the carotid bifurcation, the jugular foramen, the vagal nerve, and in the middle ear. Defects in SDHB are a cause of paraganglioma and gastric stromal sarcoma (PGGSS); also called Carney-Stratakis syndrome. Gastrointestinal stromal tumors may be sporadic or inherited in an autosomal dominant manner, alone or as a component of a syndrome associated with other tumors, such as in the context of neurofibromatosis type 1 (NF1). Patients have both gastrointestinal stromal tumors and paragangliomas. Susceptibility to the tumors was inherited in an apparently autosomal dominant manner, with incomplete penetrance. Defects in SDHB are a cause of Cowden-like syndrome (CWDLS). Cowden-like syndrome is a cancer predisposition syndrome associated with elevated risk for tumors of the breast, thyroid, kidney and uterus. Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.

Protein type: EC 1.3.5.1; Mitochondrial; Carbohydrate Metabolism - citrate (TCA) cycle; Oxidoreductase; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 1p36.1-p35

Cellular Component: mitochondrial respiratory chain complex II; mitochondrion; mitochondrial inner membrane

Molecular Function: 2 iron, 2 sulfur cluster binding; ubiquinone binding; succinate dehydrogenase (ubiquinone) activity; protein binding; electron carrier activity; metal ion binding; 4 iron, 4 sulfur cluster binding; 3 iron, 4 sulfur cluster binding

Biological Process: succinate metabolic process; cellular metabolic process; tricarboxylic acid cycle; aerobic respiration

Disease: Gastrointestinal Stromal Tumor; Cowden Syndrome 2; Paraganglioma And Gastric Stromal Sarcoma; Paragangliomas 4; Pheochromocytoma

Research Articles on SDHB

Similar Products

Product Notes

The SDHB sdhb (Catalog #AAA3208809) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SDHB antibody - middle region reacts with Tested: Human Predicted Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SDHB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SDHB sdhb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YRWMIDSRDD FTEERLAKLQ DPFSLYRCHT IMNCTRTCPK GLNPGKAIAE. It is sometimes possible for the material contained within the vial of "SDHB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.