Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of SCTR expression in rat kidney extract (lane 1) and SKOV3 whole cell lysates (lane 2). SCTR at 59KD was detected using rabbit anti- SCTR Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human, Rat SCTR Polyclonal Antibody | anti-SCTR antibody

Anti-SCTR Antibody

Gene Names
SCTR; SR
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
SCTR; Polyclonal Antibody; Anti-SCTR Antibody; SCT-R; Secretin receptor; SR; P47872; anti-SCTR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
440
Applicable Applications for anti-SCTR antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SCTR (398-440aa EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII).
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of SCTR expression in rat kidney extract (lane 1) and SKOV3 whole cell lysates (lane 2). SCTR at 59KD was detected using rabbit anti- SCTR Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of SCTR expression in rat kidney extract (lane 1) and SKOV3 whole cell lysates (lane 2). SCTR at 59KD was detected using rabbit anti- SCTR Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-SCTR antibody
Rabbit IgG polyclonal antibody for Secretin receptor(SCTR) detection.
Background: Human secretin receptor (gene name SCTR) is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. The SCTR gene is mapped to chromosome 2q14.1 by fluorescence in situ hybridization.
References
1. Dong M; Miller LJ (2002). "Molecular pharmacology of the secretin receptor". Recept. Channels 8 (3-4): 189-200.
2. Chow, B. K.-C. Molecular cloning and functional characterization of a human secretin receptor. Biochem. Biophys. Res. Commun. 212: 204-211, 1995.
3. Mark, H. F. L., Chow, B. K.-C. Localization of the gene encoding the secretin receptor, SCTR, on human chromosome 2q14.1 by fluorescence in situ hybridization and chromosome morphometry. Genomics 29: 817-818, 1995.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,207 Da
NCBI Official Full Name
secretin receptor
NCBI Official Synonym Full Names
secretin receptor
NCBI Official Symbol
SCTR
NCBI Official Synonym Symbols
SR
NCBI Protein Information
secretin receptor
UniProt Protein Name
Secretin receptor
Protein Family
UniProt Gene Name
SCTR
UniProt Synonym Gene Names
SCT-R

NCBI Description

The protein encoded by this gene is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. [provided by RefSeq, Jul 2008]

Uniprot Description

SCTR: This is a receptor for secretin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Belongs to the G-protein coupled receptor 2 family.

Protein type: GPCR, family 2; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR

Chromosomal Location of Human Ortholog: 2q14.2

Cellular Component: cytoplasmic microtubule; integral to plasma membrane; plasma membrane

Molecular Function: secretin receptor activity

Biological Process: digestion; excretion

Research Articles on SCTR

Similar Products

Product Notes

The SCTR sctr (Catalog #AAA178852) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-SCTR Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SCTR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the SCTR sctr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCTR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.