Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '29380'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
1.68 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '29380' and pd.language_id = 1
Query
Database
1.51 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '29380'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
3.29 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '29380'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '29380' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '29380'
⇄⧉products_name_syn => string (120) "HLA class II histocompatibility antigen; DM beta chain (MHC class II antigen...
$value['products_name_syn']
HLA class II histocompatibility antigen; DM beta chain (MHC class II antigen DMB)(Really interesting new gene 7 protein)
⇄products_gene_name => string (10) "HLA-DMbeta"
$value['products_gene_name']
⇄products_gene_name_syn => string (7) "HLA-DMB"
$value['products_gene_name_syn']
⇄⧉products_description => string (317) "Plays a critical role in catalyzing the release of class II-associated invar...
$value['products_description']
Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.
⇄ncbi_full_name => string (54) "HLA class II histocompatibility antigen, DM beta chain"
$value['ncbi_full_name']
⇄ncbi_full_name_syn => string (51) "major histocompatibility complex, class II, DM beta"
$value['ncbi_full_name_syn']
⇄ncbi_symbol => string (7) "HLA-DMB"
$value['ncbi_symbol']
⇄ncbi_symbol_syn => string (14) "RING7; D6S221E"
$value['ncbi_symbol_syn']
⇄⧉ncbi_protein_info => string (232) "HLA class II histocompatibility antigen, DM beta chain; MHC class II HLA-DMB...
$value['ncbi_protein_info']
HLA class II histocompatibility antigen, DM beta chain; MHC class II HLA-DMB; MHC class II antigen DMB; really interesting new gene 7 protein; MHC class II antigen HLA-DM beta chain; class II histocompatibility antigen, M beta chain
⇄ncbi_chrom_loc => string (3) "N/A"
$value['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3109"
$value['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "28,943 Da"
$value['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (375) "Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!...
$value['ncbi_pathways']
Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Asthma Pathway||83120!!Asthma Pathway||532!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533
⇄sp_protein_name => string (54) "HLA class II histocompatibility antigen, DM beta chain"
$value['sp_protein_name']
⇄sp_protein_name_syn => string (63) "MHC class II antigen DMB; Really interesting new gene 7 protein"
⇄⧉products_name_syn => string (120) "HLA class II histocompatibility antigen; DM beta chain (MHC class II antigen...
$value->a['products_name_syn']
HLA class II histocompatibility antigen; DM beta chain (MHC class II antigen DMB)(Really interesting new gene 7 protein)
⇄products_gene_name => string (10) "HLA-DMbeta"
$value->a['products_gene_name']
⇄products_gene_name_syn => string (7) "HLA-DMB"
$value->a['products_gene_name_syn']
⇄⧉products_description => string (317) "Plays a critical role in catalyzing the release of class II-associated invar...
$value->a['products_description']
Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.
⇄ncbi_full_name => string (54) "HLA class II histocompatibility antigen, DM beta chain"
$value->a['ncbi_full_name']
⇄ncbi_full_name_syn => string (51) "major histocompatibility complex, class II, DM beta"
$value->a['ncbi_full_name_syn']
⇄ncbi_symbol => string (7) "HLA-DMB"
$value->a['ncbi_symbol']
⇄ncbi_symbol_syn => string (14) "RING7; D6S221E"
$value->a['ncbi_symbol_syn']
⇄⧉ncbi_protein_info => string (232) "HLA class II histocompatibility antigen, DM beta chain; MHC class II HLA-DMB...
$value->a['ncbi_protein_info']
HLA class II histocompatibility antigen, DM beta chain; MHC class II HLA-DMB; MHC class II antigen DMB; really interesting new gene 7 protein; MHC class II antigen HLA-DM beta chain; class II histocompatibility antigen, M beta chain
⇄ncbi_chrom_loc => string (3) "N/A"
$value->a['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3109"
$value->a['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "28,943 Da"
$value->a['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (375) "Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!...
$value->a['ncbi_pathways']
Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Asthma Pathway||83120!!Asthma Pathway||532!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533
⇄sp_protein_name => string (54) "HLA class II histocompatibility antigen, DM beta chain"
$value->a['sp_protein_name']
⇄sp_protein_name_syn => string (63) "MHC class II antigen DMB; Really interesting new gene 7 protein"
⇄⧉products_name_syn => string (120) "HLA class II histocompatibility antigen; DM beta chain (MHC class II antigen...
$value->d['products_name_syn']
HLA class II histocompatibility antigen; DM beta chain (MHC class II antigen DMB)(Really interesting new gene 7 protein)
⇄products_gene_name => string (10) "HLA-DMbeta"
$value->d['products_gene_name']
⇄products_gene_name_syn => string (7) "HLA-DMB"
$value->d['products_gene_name_syn']
⇄⧉products_description => string (317) "Plays a critical role in catalyzing the release of class II-associated invar...
$value->d['products_description']
Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.
⇄ncbi_full_name => string (54) "HLA class II histocompatibility antigen, DM beta chain"
$value->d['ncbi_full_name']
⇄ncbi_full_name_syn => string (51) "major histocompatibility complex, class II, DM beta"
$value->d['ncbi_full_name_syn']
⇄ncbi_symbol => string (7) "HLA-DMB"
$value->d['ncbi_symbol']
⇄ncbi_symbol_syn => string (14) "RING7; D6S221E"
$value->d['ncbi_symbol_syn']
⇄⧉ncbi_protein_info => string (232) "HLA class II histocompatibility antigen, DM beta chain; MHC class II HLA-DMB...
$value->d['ncbi_protein_info']
HLA class II histocompatibility antigen, DM beta chain; MHC class II HLA-DMB; MHC class II antigen DMB; really interesting new gene 7 protein; MHC class II antigen HLA-DM beta chain; class II histocompatibility antigen, M beta chain
⇄ncbi_chrom_loc => string (3) "N/A"
$value->d['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3109"
$value->d['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "28,943 Da"
$value->d['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (375) "Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!...
$value->d['ncbi_pathways']
Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Asthma Pathway||83120!!Asthma Pathway||532!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533
⇄sp_protein_name => string (54) "HLA class II histocompatibility antigen, DM beta chain"
$value->d['sp_protein_name']
⇄sp_protein_name_syn => string (63) "MHC class II antigen DMB; Really interesting new gene 7 protein"
⇄⧉products_name_syn => string (120) "HLA class II histocompatibility antigen; DM beta chain (MHC class II antigen...
$value[0]['_source']['products_name_syn']
HLA class II histocompatibility antigen; DM beta chain (MHC class II antigen DMB)(Really interesting new gene 7 protein)
⇄products_gene_name => string (10) "HLA-DMbeta"
$value[0]['_source']['products_gene_name']
⇄products_gene_name_syn => string (7) "HLA-DMB"
$value[0]['_source']['products_gene_name_syn']
⇄⧉products_description => string (317) "Plays a critical role in catalyzing the release of class II-associated invar...
$value[0]['_source']['products_description']
Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.
⇄ncbi_full_name => string (54) "HLA class II histocompatibility antigen, DM beta chain"
$value[0]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (51) "major histocompatibility complex, class II, DM beta"
$value[0]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (7) "HLA-DMB"
$value[0]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (14) "RING7; D6S221E"
$value[0]['_source']['ncbi_symbol_syn']
⇄⧉ncbi_protein_info => string (232) "HLA class II histocompatibility antigen, DM beta chain; MHC class II HLA-DMB...
$value[0]['_source']['ncbi_protein_info']
HLA class II histocompatibility antigen, DM beta chain; MHC class II HLA-DMB; MHC class II antigen DMB; really interesting new gene 7 protein; MHC class II antigen HLA-DM beta chain; class II histocompatibility antigen, M beta chain
⇄ncbi_chrom_loc => string (3) "N/A"
$value[0]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3109"
$value[0]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "28,943 Da"
$value[0]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (375) "Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!...
$value[0]['_source']['ncbi_pathways']
Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Asthma Pathway||83120!!Asthma Pathway||532!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533
⇄sp_protein_name => string (54) "HLA class II histocompatibility antigen, DM beta chain"
$value[0]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (63) "MHC class II antigen DMB; Really interesting new gene 7 protein"
⇄host => string (48) "E Coli or Yeast or Baculovirus or Mammalian Cell"
$value[1]['_source']['host']
⇄reactivity => string (3) "N/A"
$value[1]['_source']['reactivity']
⇄specificity => string (3) "N/A"
$value[1]['_source']['specificity']
⇄purity => string (57) "Greater or equal to 85% purity as determined by SDS-PAGE."
$value[1]['_source']['purity']
⇄⧉form => string (80) "Lyophilized or liquid (Format to be determined during the manufacturing proc...
$value[1]['_source']['form']
Lyophilized or liquid (Format to be determined during the manufacturing process)
⇄concentration => string (3) "N/A"
$value[1]['_source']['concentration']
⇄⧉storage_stability => string (195) "Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80...
$value[1]['_source']['storage_stability']
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
⇄⧉search_terms => string (1328) "aaa18682 e coli or yeast baculovirus mammalian cell greater equal to 85 puri...
$value[1]['_source']['search_terms']
aaa18682 e coli or yeast baculovirus mammalian cell greater equal to 85 purity as determined by sds page lyophilized liquid format be during the manufacturing process aaa18682_sds gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqkmeprapwieqegpeywdqetrnmkahsqtdranlgtlrgyynqsedgshtiqimygcdvgpdgrflrgyrqdaydgkdyialnedlrswtaadmaaqitkrkweavhaaeqrrvylegrcvdglrrylengketlqrtdppkthmthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdgtfqkwaavvvpsgeeqrytchvqheglpkpltlrwelssqptipi
recombinant protein hla class i histocompatibility antigen a 1 alpha chain human partial a*01:01:01:01 major complex hlaa 36.7 kda mhc a*1 337752170 np_001229687.1 p01891 p01892 p04439 p05534 p10314 p10316 p13746 p16188 p16189 p16190 nm_001242758.1 p30443 o77964 o78171 q9mya3 q9tp25 q9tqp5 142800 species homo sapiens production note special offer host expressed is manufactured from stock plasmid containing gene colihost stocked in different unit sizes ranging small 10 ug large mg bulk inventory also available has been ordered over and again researchers stood test of time both robust important target for research community it part our new program make most popular targets corresponding hosts expanded with quick processing select fastest delivery among all please contact technical support team email [email protected] more details to85 a1 small10
⇄⧉specificity => string (376) "This assay has high sensitivity and excellent specificity for detection of H...
$value[2]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of HLAE. No significant cross-reactivity or interference between HLAE and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between HLAE and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[2]['_source']['purity']
⇄form => string (3) "N/A"
$value[2]['_source']['form']
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
Assay Type||Quantitative Competitive!!Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Sensitivity||0.1 ng/mL
⇄⧉etc_term2 => string (400) "Intended Uses||This HLA-E ELISA kit is a 1.5 hour solid-phase ELISA designed...
$value[2]['_source']['etc_term2']
Intended Uses||This HLA-E ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse HLA-E. This ELISA kit for research use only, not for therapeutic applications!!!Intended Uses||This HLA-E ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse HLA-E. This ELISA kit for research use only, not for therapeutic applications!
⇄products_name_oem => string (35) "Mouse Leukocyte antigen E ELISA Kit"
$value[2]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[2]['_source']['products_name_syn']
⇄products_gene_name => string (5) "HLA-E"
$value[2]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[2]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1389) "Principle of the Assay: HLAE ELISA kit applies the competitive enzyme immuno...
$value[2]['_source']['products_description']
Principle of the Assay: HLAE ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-HLAE antibody and an HLAE-HRP conjugate. The assay sample and buffer are incubated together with HLAE-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the HLAE concentration since HLAE from samples and HLAE-HRP conjugate compete for the anti-HLAE antibody binding site. Since the number of sites is limited, as more sites are occupied by HLAE from the sample, fewer sites are left to bind HLAE-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The HLAE concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This HLAE ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse HLAE. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄products_references => string (3) "N/A"
$value[2]['_source']['products_references']
⇄⧉products_related_diseases => string (191) "Nervous System Diseases||20!!Skin Diseases||20!!Necrosis||18!!Liver Diseases...
$value[2]['_source']['products_related_diseases']
Nervous System Diseases||20!!Skin Diseases||20!!Necrosis||18!!Liver Diseases||17!!Inflammation||16!!Kidney Diseases||5!!Heart Diseases||5!!Skin Neoplasms||4!!Psoriasis||4!!Breast Neoplasms||4
⇄products_categories => string (10) "Immunology"
$value[2]['_source']['products_categories']
⇄ncbi_full_name => string (53) "HLA class I histocompatibility antigen, alpha chain E"
$value[2]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (44) "major histocompatibility complex, class I, E"
⇄⧉ncbi_protein_info => string (191) "HLA class I histocompatibility antigen, alpha chain E; MHC HLA-E alpha-1; ly...
$value[2]['_source']['ncbi_protein_info']
HLA class I histocompatibility antigen, alpha chain E; MHC HLA-E alpha-1; lymphocyte antigen; MHC HLA-E alpha-2.1; MHC class I antigen E; HLA class I histocompatibility antigen, E alpha chain
⇄ncbi_chrom_loc => string (3) "N/A"
$value[2]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3133"
$value[2]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "40,157 Da"
$value[2]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (478) "Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!...
$value[2]['_source']['ncbi_pathways']
Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Presentation: Folding, Assembly And Peptide Loading Of Class I MHC Pathway||366163!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Antigen Processing-Cross Presentation Pathway||477122!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533
⇄sp_protein_name => string (53) "HLA class I histocompatibility antigen, alpha chain E"
$value[2]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (21) "MHC class I antigen E"
⇄⧉search_terms => string (604) "aaa17178 mouse elisa kit leukocyte antigen e hla class i histocompatibility ...
$value[2]['_source']['search_terms']
aaa17178 mouse elisa kit leukocyte antigen e hla class i histocompatibility alpha chain major complex mhc qa1 ea1.2 ea2.1 6.2 1 lymphocyte 2.1 40,157 da hlae hlae_human 62912479 np_005507.3 p13747 nm_005516.5 q30169 q9bt83 q9giy7 q9giy8 143010 immunology samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type competitive detection range 5.0 100ng ml sensitivity 1.0ng intended uses this is a 1.5 hour solid phase designed for the quantitative determination of research use only not therapeutic applications !intended applications! ea2.16.2 lymphocyte2.1 range5.0 a1.5
⇄⧉testing_protocols => string (1546) "IF (Immunofluorescence)||Immunofluorescence analysis of NIH/3T3 cells using ...
$value[3]['_source']['testing_protocols']
IF (Immunofluorescence)||Immunofluorescence analysis of NIH/3T3 cells using HLA-DPB1 Polyclonal Antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA22307_IF7.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of HeLa cells using HLA-DPB1 Polyclonal Antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA22307_IF6.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of C6 cells using HLA-DPB1 Polyclonal Antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA22307_IF5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded Rat spleen using HLA-DPB1 Polyclonal Antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.||AAA22307_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded Mouse spleen using HLA-DPB1 Polyclonal Antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.||AAA22307_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded Human liver cancer using HLA-DPB1 Polyclonal Antibody at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.||AAA22307_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines using HLA-DPB1 Polyclonal Antibody at 1:1000 dilution.||AAA22307_WB.jpg
⇄etc_term1 => string (48) "Immunogen||A synthetic peptide of human HLA-DPB1"
DPB1; HLA-DP; HLA-DP1B; HLA-DPB; HLA-DPB1; major histocompatibility complex; class II; DP beta 1
⇄products_gene_name => string (8) "HLA-DPB1"
$value[3]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[3]['_source']['products_gene_name_syn']
⇄⧉products_description => string (849) "HLA-DPB belongs to the HLA class II beta chain paralogues. This class II mol...
$value[3]['_source']['products_description']
HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. [provided by RefSeq, Jul 2008]
⇄products_references => string (3) "N/A"
$value[3]['_source']['products_references']
⇄⧉products_related_diseases => string (210) "Lung Diseases, Interstitial||54!!Nervous System Diseases||50!!Berylliosis||3...
$value[3]['_source']['products_related_diseases']
Lung Diseases, Interstitial||54!!Nervous System Diseases||50!!Berylliosis||37!!Skin Diseases||34!!Multiple Sclerosis||34!!Arthritis, Rheumatoid||31!!Liver Diseases||30!!Lymphoma||24!!Asthma||22!!Sarcoidosis||19
⇄⧉ncbi_protein_info => string (255) "HLA class II histocompatibility antigen, DP beta 1 chain; MHC HLA DPB1; HLA ...
$value[3]['_source']['ncbi_protein_info']
HLA class II histocompatibility antigen, DP beta 1 chain; MHC HLA DPB1; HLA DP14-beta chain; MHC class II HLA-DRB1; class II HLA beta chain; MHC class II antigen DPB1; MHC class II HLA-DP-beta-1; MHC class II antigen DPbeta1; MHC class II antigen beta cha
⇄ncbi_chrom_loc => string (3) "N/A"
$value[3]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3115"
$value[3]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "258"
$value[3]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (375) "Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!...
$value[3]['_source']['ncbi_pathways']
Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Asthma Pathway||83120!!Asthma Pathway||532!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533
⇄sp_protein_name => string (56) "HLA class II histocompatibility antigen, DP beta 1 chain"
$value[3]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (85) "HLA class II histocompatibility antigen, DP(W4) beta chain; MHC class II ant...
$value[3]['_source']['sp_protein_name_syn']
HLA class II histocompatibility antigen, DP(W4) beta chain; MHC class II antigen DPB1
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||0.5-200ng/ml!!Sensitivity||0.21ng/ml
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[4]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄products_price => string (6) "0.0000"
$value[4]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[4]['_source']['products_weight']
⇄products_status => boolean true
$value[4]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[4]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "160"
$value[4]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[4]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[4]['_source']['language_id']
⇄products_name => string (26) "leukocyte antigen A, HLA-A"
⇄⧉products_description => string (893) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[4]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Human HLA-A antibody. HLA-A present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Human HLA-A Antibody is added and binds to HLA-A in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated HLA-A antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Human HLA-A. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Human leukocyte antigen A (also known as HLA-A) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄products_references => string (3) "N/A"
$value[4]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[4]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[4]['_source']['products_categories']
⇄ncbi_full_name => string (5) "HLA-A"
$value[4]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (44) "major histocompatibility complex, class I, A"
$value[4]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (5) "HLA-A"
$value[4]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (4) "HLAA"
$value[4]['_source']['ncbi_symbol_syn']
⇄⧉ncbi_protein_info => string (133) "HLA class I histocompatibility antigen, A-1 alpha chain; LOW QUALITY PROTEIN...
$value[4]['_source']['ncbi_protein_info']
HLA class I histocompatibility antigen, A-1 alpha chain; LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, A-1 alpha chain
⇄ncbi_chrom_loc => string (3) "N/A"
$value[4]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3105"
$value[4]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "40,909 Da"
$value[4]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (488) "Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||83123!!...
$value[4]['_source']['ncbi_pathways']
Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Presentation: Folding, Assembly And Peptide Loading Of Class I MHC Pathway||366163!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Antigen Processing-Cross Presentation Pathway||477122!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533!!Cell Adhesion Molecules (CAMs) Pathway||83069
⇄sp_protein_name => string (56) "HLA class I histocompatibility antigen, A-68 alpha chain"
$value[4]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (89) "Aw-68; HLA class I histocompatibility antigen, A-28 alpha chain; MHC class I...
$value[4]['_source']['sp_protein_name_syn']
Aw-68; HLA class I histocompatibility antigen, A-28 alpha chain; MHC class I antigen A*68
⇄sp_gene_name => string (5) "HLA-A"
$value[4]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (4) "HLAA"
$value[4]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[4]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[4]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[4]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[4]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[4]['_source']['products_viewed']
⇄⧉search_terms => string (752) "aaa11102 human typical testing data standard curve for reference only aaa111...
$value[4]['_source']['search_terms']
aaa11102 human typical testing data standard curve for reference only aaa11102_sc elisa kit leukocyte antigen a hla major histocompatibility complex class i hlaa 1 alpha chain low quality protein 40,909 da 68 aw 28 mhc a*68 1407575 baa07530.1 p01891 p01892 p04439 p05534 p10314 p10316 p13746 p16188 p16189 p16190 o19673 o19695 o19794 o19795 o43907 o77938 o98010 p10315 p79505 q9mya5 q9myc4 samples serum plasma cell culture supernates ascites tissue homogenates or other biological fluids assay type quantitative sandwich detection range 0.5 200ng ml sensitivity 0.21ng intra precision within an three of known concentration were tested on one plate to assess cv<8 inter between assays in separate cv = sd mean x 100 cv<10 hlaa1 da68 aw28 range0.5 x100
⇄⧉storage_stability => string (417) "Store at 4 degree C or at -20 degree C if preferred. This product should be ...
$value[5]['_source']['storage_stability']
Store at 4 degree C or at -20 degree C if preferred. This product should be stored undiluted. Storage in frost free freezers is not recommended. This product is photosensitive and should be protected from light. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.<br>Shelf Life: 18 months from date of despatch.
⇄⧉app_notes => string (137) "Flow Cytometry: Use 10ul of the suggested working dilution to label 106 cell...
$value[5]['_source']['app_notes']
Flow Cytometry: Use 10ul of the suggested working dilution to label 106 cells in 100ul. <br><b>Flow Cytometry: </b>Maximum Dilution: Neat
⇄⧉testing_protocols => string (738) "Application Data||Staining of human peripheral blood lymphocytes with Mouse ...
$value[5]['_source']['testing_protocols']
Application Data||Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC:Alexa Fluor 647||AAA11891_APP6.gif!!Application Data||Staining of human peripheral blood monocytes with Mouse anti Human HLA ABC:Biotin||AAA11891_APP5.gif!!Application Data||Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC||AAA11891_APP4.gif!!Application Data||Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC:Alexa Fluor 488||AAA11891_APP3.gif!!Application Data||Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC:FITC||AAA11891_APP2.gif!!Application Data||Staining of peripheral blood lymphocytes with Mouse anti Human HLA-ABC: Low Endotoxin||AAA11891_APP.jpg
Perservative Stabilisers||0.09% Sodium Azide<br>1% Bovine Serum Albumin<br>Preparation||Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant.
⇄⧉etc_term2 => string (248) "Immunogen||Purified human tonsil lymphocyte membranes.<br>Fusion Partners||S...
$value[5]['_source']['etc_term2']
Immunogen||Purified human tonsil lymphocyte membranes.<br>Fusion Partners||Spleen cells from immunised BALB/c mice were fused with cells of the mouse NSI/I-Ag4.1 myeloma cell line<br>Buffer Solution||Phosphate buffered saline!!Target Species||Human
⇄products_price => string (6) "0.0000"
$value[5]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[5]['_source']['products_weight']
⇄products_status => boolean true
$value[5]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[5]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "210"
$value[5]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[5]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[5]['_source']['language_id']
⇄products_name => string (7) "HLA ABC"
$value[5]['_source']['products_name']
⇄products_name_oem => string (29) "MOUSE ANTI HUMAN HLA ABC:FITC"
$value[5]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[5]['_source']['products_name_syn']
⇄products_gene_name => string (7) "HLA ABC"
$value[5]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[5]['_source']['products_gene_name_syn']
⇄⧉products_description => string (735) "Mouse anti Human HLA ABC antibody, clone W6/32 recognizes an antigenic deter...
$value[5]['_source']['products_description']
Mouse anti Human HLA ABC antibody, clone W6/32 recognizes an antigenic determinant shared among products of the HLA A, B and C loci. Clone W6/32 recognizes a conformational epitope, reacting with HLA class I alpha3 and alpha2 domains. The major histocompatibility complex (MHC) is a cluster of genes that are important in the immune response to infections. In humans, this complex is referred to as the human leukocyte antigen (HLA) region. There are 3 major MHC class I proteins encoded by the HLA which are HLA A, HLA B and HLA C. These proteins are found on the surface of almost all nucleated somatic cells. Mouse anti Human HLA ABC antibody, clone W6/32 is routinely tested in flow cytometry on human peripheral blood lymphocytes.
WB: 1:1000<br>IHC: 1:100-1:500. Epitope retrieval with citrate buffer pH 6.0 is recommended for FFPE tissue sections.<br>ICC: 1:100-1:500. Epitope retrieval with citrate buffer pH 6.0 is recommended for FFPE cell sections.<br>IHC-IF: 1:100 to 1:500. Epitope retrieval with citrate buffer pH6.0 is recommended for FFPE cell sections.<br>FC/FACS: Live or cells fixed in 4% formaldehyde and permeabilized with 90% methanol. 0.5 ul per 1 x 10^6 cells.
⇄⧉testing_protocols => string (2003) "WB (Western Blot)||<b>Detection of human HLA-DR by western blot.</b> <i>Samp...
$value[6]['_source']['testing_protocols']
WB (Western Blot)||<b>Detection of human HLA-DR by western blot.</b> <i>Samples:</i> Whole cell lysate (50 ug) from KG-1, SNB-75, Raji, Ramos, and SR (10 ug) cells prepared using NETN lysis buffer. <i>Antibody:</i> Mouse anti-HLA-DR monoclonal antibody [LN3] (AAA23780 lot 2) used at 1:1000. <i>Secondary:</i> HRP-conjugated goat anti-mouse IgG . <i>Detection:</i> Chemiluminescence with an exposure time of 3 minutes. Lower Panel: Rabbit anti-Actin recombinant monoclonal antibody .||AAA23780_WB6.jpg!!IHC (Immunohistochemistry)||<b>Detection of human HLA-DR (red) by immunohistochemistry.</b> <i>Sample:</i> FFPE section of human tonsil. <i>Antibody:</i> Mouse anti-HLA-DR monoclonal antibody [LN3] (AAA23780 lot 1) used at 1:250. <i>Secondary:</i> HRP-conjugated goat anti-Mouse IgG . <i>Substrate:</i> Opal. <i>Counterstain:</i> DAPI (blue).||AAA23780_IHC5.jpg!!IHC (Immunohistochemistry)||<b>Detection of human HLA-DR by immunhistochemistry.</b> <i>Sample:</i> FFPE section of human tonsil. <i>Antibody:</i> Mouse monoclonal anti-HLA-DR antibody [LN3] (AAA23780 lot 1) used at 1:100. <i>Secondary:</i> DyLight 594-conjugated goat anti-mouse IgG .||AAA23780_IHC4.jpg!!IHC (Immunohistochemistry)||<b>Detection of human HLA-DR by immunohistochemistry.</b> <i>Sample:</i> FFPE section of tonsil. <i>Antibody:</i> Mouse anti-HLA-DR monoclonal antibody [LN3] (AAA23780-2). <i>Secondary:</i> HRP-conjugated goat anti-mouse IgG .||AAA23780_IHC3.jpg!!ICC (Immunocytochemistry)||<b>Detection of human HLA-DR by immunocytochemistry.</b> <i>Sample:</i> FFPE section of SR cells. <i>Antibody:</i> Mouse anti-HLA-DR monoclonal antibody [LN3] (AAA23780-2). <i>Secondary:</i> HRP-conjugated goat anti-mouse IgG .||AAA23780_ICC2.jpg!!FCM (Flow Cytometry)||<b>Detection of human HLA-DR (shaded) in Daudi cells by flow cytometry.</b> <i>Antibody:</i> Mouse anti-HLA-DR monoclonal antibody [LN3] (AAA23780) or isotype control (unshaded). <i>Secondary:</i> DyLight 488-conjugated goat anti-mouse IgG .||AAA23780_FCM.jpg
⇄⧉etc_term1 => string (88) "Immunogen||Activated human peripheral blood mononuclear cells!!Conjugation||...
$value[6]['_source']['etc_term1']
Immunogen||Activated human peripheral blood mononuclear cells!!Conjugation||Unconjugated
⇄⧉products_name_syn => string (243) "MHC class II antigen DRA; HLA-DRA1; histocompatibility antigen HLA-DR alpha;...
$value[6]['_source']['products_name_syn']
MHC class II antigen DRA; HLA-DRA1; histocompatibility antigen HLA-DR alpha; HLA class II histocompatibility antigen, DR alpha chain; HLA class II histocompatibility antigen, DR alpha chain; major histocompatibility complex, class II, DR alpha
⇄products_gene_name => string (6) "HLA-DR"
$value[6]['_source']['products_gene_name']
⇄products_gene_name_syn => string (7) "HLA-DRA"
$value[6]['_source']['products_gene_name_syn']
⇄⧉products_description => string (789) "HLA-DRA is one of the HLA class II alpha chain paralogues. This class II mol...
$value[6]['_source']['products_description']
HLA-DRA is one of the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha and a beta chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. DRA does not have polymorphisms in the peptide binding part and acts as the sole alpha chain for DRB1, DRB3, DRB4 and DRB5 [taken from NCBI Entrez Gene (Gene ID: 3122)].
⇄products_references => string (3) "N/A"
$value[6]['_source']['products_references']
⇄⧉products_related_diseases => string (219) "Nervous System Diseases||75!!Skin Diseases||47!!Multiple Sclerosis||44!!Necr...
⇄ncbi_full_name => string (55) "HLA class II histocompatibility antigen, DR alpha chain"
$value[6]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (52) "major histocompatibility complex, class II, DR alpha"
$value[6]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (7) "HLA-DRA"
$value[6]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (14) "MLRW; HLA-DRA1"
$value[6]['_source']['ncbi_symbol_syn']
⇄⧉ncbi_protein_info => string (153) "HLA class II histocompatibility antigen, DR alpha chain; MHC cell surface gl...
$value[6]['_source']['ncbi_protein_info']
HLA class II histocompatibility antigen, DR alpha chain; MHC cell surface glycoprotein; MHC class II antigen DRA; histocompatibility antigen HLA-DR alpha
⇄ncbi_chrom_loc => string (3) "N/A"
$value[6]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3122"
$value[6]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "28,607 Da"
$value[6]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (375) "Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!...
$value[6]['_source']['ncbi_pathways']
Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Asthma Pathway||83120!!Asthma Pathway||532!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533
⇄sp_protein_name => string (55) "HLA class II histocompatibility antigen, DR alpha chain"
$value[6]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (24) "MHC class II antigen DRA"
⇄⧉products_description => string (256) "Involved in the presentation of foreign antigens to the immune system. Plays...
$value[7]['_source']['products_description']
Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.
⇄⧉products_references => string (1527) "The mRNA of a human class I gene HLA G/HLA 6.0 exhibits a restricted pattern...
$value[7]['_source']['products_references']
The mRNA of a human class I gene HLA G/HLA 6.0 exhibits a restricted pattern of expression.Shukla H., Swaroop A., Srivastava R., Weissman S.M.Nucleic Acids Res. 18:2189-2189(1990)
A human major histocompatibility complex class I gene that encodes a protein with a shortened cytoplasmic segment.Geraghty D.E., Koller B.H., Orr H.T.Proc. Natl. Acad. Sci. U.S.A. 84:9145-9149(1987)
Ishitani A., Geraghty D.E. A 356-Kb sequence of the subtelomeric part of the MHC class I region.Hampe A., Coriton O., Andrieux N., Carn G., Lepourcelet M., Mottier S., Dreano S., Gatius M.T., Hitte C., Soriano N., Galibert F.DNA Seq. 10:263-299(1999)
Homo sapiens 2,229,817bp genomic DNA of 6p21.3 HLA class I region.Shiina S., Tamiya G., Oka A., Inoko H.Disulfide bond-mediated dimerization of HLA-G on the cell surface.Boyson J.E., Erskine R., Whitman M.C., Chiu M., Lau J.M., Koopman L.A., Valter M.M., Angelisova P., Horejsi V., Strominger J.L.Proc. Natl. Acad. Sci. U.S.A. 99:16180-16185(2002)
Crystal structure of HLA-G
a nonclassical MHC class I molecule expressed at the fetal-maternal interface.Clements C.S., Kjer-Nielsen L., Kostenko L., Hoare H.L., Dunstone M.A., Moses E., Freed K., Brooks A.G., Rossjohn J., McCluskey J.Proc. Natl. Acad. Sci. U.S.A. 102:3360-3365(2005)
Efficient leukocyte Ig-like receptor signaling and crystal structure of disulfide-linked HLA-G dimer.Shiroishi M., Kuroki K., Ose T., Rasubala L., Shiratori I., Arase H., Tsumoto K., Kumagai I., Kohda D., Maenaka K.J. Biol. Chem. 281:10439-10447(2006)
⇄⧉products_related_diseases => string (202) "Inflammation||89!!Skin Diseases||85!!Necrosis||54!!Nervous System Diseases||...
$value[7]['_source']['products_related_diseases']
Inflammation||89!!Skin Diseases||85!!Necrosis||54!!Nervous System Diseases||41!!Breast Neoplasms||38!!Asthma||35!!Ovarian Neoplasms||23!!Kidney Diseases||18!!Brain Diseases||16!!Bone Marrow Diseases||16
⇄products_categories => string (10) "Immunology"
$value[7]['_source']['products_categories']
⇄ncbi_full_name => string (53) "HLA class I histocompatibility antigen, alpha chain G"
$value[7]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[7]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[7]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[7]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[7]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[7]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3135"
$value[7]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (8) "39.6 kDa"
$value[7]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (481) "Adaptive Immune System Pathway||1269171!!Allograft Rejection Pathway||920963...
$value[7]['_source']['ncbi_pathways']
Adaptive Immune System Pathway||1269171!!Allograft Rejection Pathway||920963!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Presentation: Folding, Assembly And Peptide Loading Of Class I MHC Pathway||1269194!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Antigen Processing-Cross Presentation Pathway||1269195!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533
⇄sp_protein_name => string (53) "HLA class I histocompatibility antigen, alpha chain G"
$value[7]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (36) "HLA G antigen; MHC class I antigen G"
⇄⧉search_terms => string (1223) "aaa15926 e coli or yeast baculovirus mammalian cell greater equal to 85 puri...
$value[7]['_source']['search_terms']
aaa15926 e coli or yeast baculovirus mammalian cell greater equal to 85 purity as determined by sds page lyophilized liquid format be during the manufacturing process aaa15926_sds gshsmryfsaavsrpgrgeprfiamgyvddtqfvrfdsdsacprmeprapwveqegpeyweeetrntkahaqtdrmnlqtlrgyynqseasshtlqwmigcdlgsdgrllrgyeqyaydgkdylalnedlrswtaadtaaqiskrkceaanvaeqrraylegtcvewlhrylengkemlqradppkthvthhpvfdyeatlrcwalgfypaeiiltwqrdgedqtqdvelvetrpagdgtfqkwaavvvpsgeeqrytchvqheglpeplmlrwkqsslptipimgivaglvvlaavvtgaavaavlwrkkssd
recombinant protein hla class i histocompatibility antigen alpha chain g human mhc 6.0 hlag 39.6 kda hlag_human 4504415 np_002118.1 nm_002127.5 p17693 142871 immunology production note special offer host expressed is manufactured from a stock plasmid containing gene cellhost stocked in different unit sizes ranging small 10 ug large 1 mg bulk inventory also available has been ordered over and again researchers stood test of time both robust important target for research community it part our new program make most popular targets corresponding hosts expanded with quick processing select fastest delivery among all please contact technical support team email [email protected] more details to85 mhc6.0 small10 large1
⇄concentration => string (73) "Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml."
$value[8]['_source']['concentration']
⇄⧉storage_stability => string (220) "Store at -20 degree C for one year from date of receipt. After reconstitutio...
$value[8]['_source']['storage_stability']
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.
WB: 0.25-0.5 ug/ml, Human<br>IHC-P: 2-5 ug/ml, Human<br>FC/FACS: 1-3 ug/1x10^6 cells, Human<br>Tested Species: In-house tested species with positive results.<br>Enhanced Chemiluminescent Kit with anti- IgG for Western blot, and HRP Conjugated anti- IgG Super Vision Assay Kit for IHC(P).
FCM (Flow Cytometry)||Figure 6. Flow Cytometry analysis of Daudi cells using anti-HLA-DRA antibody (AAA19680).<br><br>Overlay histogram showing Daudi cells stained with AAA19680 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-HLA-DRA Antibody (AAA19680, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.||AAA19680_FCM6.jpg!!IHC (Immunohistochemistry)||Figure 5. IHC analysis of HLA-DRA using anti-HLA-DRA antibody (AAA19680).<br><br>HLA-DRA was detected in a paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-HLA-DRA Antibody (AAA19680) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.||AAA19680_IHC5.jpg!!IHC (Immunohistochemistry)||Figure 4. IHC analysis of HLA-DRA using anti-HLA-DRA antibody (AAA19680).<br><br>HLA-DRA was detected in a paraffin-embedded section of human rectal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-HLA-DRA Antibody (AAA19680) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.||AAA19680_IHC4.jpg!!IHC (Immunohistochemistry)||Figure 3. IHC analysis of HLA-DRA using anti-HLA-DRA antibody (AAA19680).<br><br>HLA-DRA was detected in a paraffin-embedded section of human mammary infiltrate tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-HLA-DRA Antibody (AAA19680) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.||AAA19680_IHC3.jpg!!IHC (Immunohistochemistry)||Figure 2. IHC analysis of HLA-DRA using anti-HLA-DRA antibody (AAA19680).<br><br>HLA-DRA was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-HLA-DRA Antibody (AAA19680) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.||AAA19680_IHC2.jpg!!WB (Western Blot)||Figure 1. Western blot analysis of HLA-DRA using anti-HLA-DRA antibody (AAA19680).<br><br>Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.<br><br>Lane 1: human Raji whole cell lysates,<br>Lane 2: human Daudi whole cell lysates.<br><br>After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-HLA-DRA antigen affinity purified monoclonal antibody (#AAA19680) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for HLA-DRA at approximately 35-37 kDa. The expected band size for HLA-DRA is at 29 kDa.||AAA19680_WB.jpg
⇄⧉etc_term1 => string (89) "Reconstitution||Adding 0.2 ml of distilled water will yield a concentration ...
$value[8]['_source']['etc_term1']
Reconstitution||Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
⇄⧉etc_term2 => string (88) "Immunogen||E Coli-derived human HLA-DR/HLA-DRA recombinant protein (Position...
$value[8]['_source']['etc_term2']
Immunogen||E Coli-derived human HLA-DR/HLA-DRA recombinant protein (Position: I26-L254).
⇄⧉products_description => string (880) "HLA class II histocompatibility antigen, DR alpha chainis aproteinthat in hu...
$value[8]['_source']['products_description']
HLA class II histocompatibility antigen, DR alpha chainis aproteinthat in humans is encoded by the HLA-DRAgene. It is mapped to 6p21.32. HLA-DRA is one of the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha and a beta chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. DRA does not have polymorphisms in the peptide binding part and acts as the sole alpha chain for DRB1, DRB3, DRB4 and DRB5.
⇄products_references => string (3) "N/A"
$value[8]['_source']['products_references']
⇄⧉products_related_diseases => string (219) "Nervous System Diseases||75!!Skin Diseases||47!!Multiple Sclerosis||44!!Necr...
⇄ncbi_full_name => string (55) "HLA class II histocompatibility antigen, DR alpha chain"
$value[8]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (52) "major histocompatibility complex, class II, DR alpha"
$value[8]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (7) "HLA-DRA"
$value[8]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (14) "MLRW; HLA-DRA1"
$value[8]['_source']['ncbi_symbol_syn']
⇄⧉ncbi_protein_info => string (153) "HLA class II histocompatibility antigen, DR alpha chain; MHC class II antige...
$value[8]['_source']['ncbi_protein_info']
HLA class II histocompatibility antigen, DR alpha chain; MHC class II antigen DRA; MHC cell surface glycoprotein; histocompatibility antigen HLA-DR alpha
⇄ncbi_chrom_loc => string (3) "N/A"
$value[8]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3122"
$value[8]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "254"
$value[8]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (375) "Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!...
$value[8]['_source']['ncbi_pathways']
Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Asthma Pathway||83120!!Asthma Pathway||532!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533
⇄sp_protein_name => string (55) "HLA class II histocompatibility antigen, DR alpha chain"
$value[8]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (24) "MHC class II antigen DRA"
⇄⧉testing_protocols => string (935) "IF (Immunofluorescence)||Immunofluorescence analysis of U2OS cell using HLA-...
$value[9]['_source']['testing_protocols']
IF (Immunofluorescence)||Immunofluorescence analysis of U2OS cell using HLA-A antibody. Blue: DAPI for nuclear staining||AAA29698_IF6.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse liver using HLA-A antibody at dilution of 1:500 (200x lens).||AAA29698_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded mouse kidney using HLA-A antibody at dilution of 1:500 (200x lens).||AAA29698_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human neurilemmoma using HLA-A antibody at dilution of 1:500 (200x lens)..||AAA29698_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemical analysis of paraffin-embedded human endometrial cancer using HLA-A antibody at dilution of 1:500 (200x lens).||AAA29698_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using HLA-A antibody.||AAA29698_WB.jpg
⇄⧉products_description => string (579) "Human major histocompatibility complex (MHC) antigens, also referred to as h...
$value[9]['_source']['products_description']
Human major histocompatibility complex (MHC) antigens, also referred to as human leukocyte antigens (HLA), are encoded by genes located on the short arm of chromosome 6 (6p21.3). There are two classes of HLA antigens: class I (HLA-A, B and C) and class II (HLA-D). This class I molecules are polymorphic membrane glycoproteins composed of a heavy (alpha) chain (44 kDa) which is encoded by a HLA class I gene (HLA-A, B or C), and b2-microglobulin light (beta) chain (12 kDa). They are involved in the presentation of foreign antigens to the immune system. (PMID: 667938; 3375250)
⇄products_references => string (3) "N/A"
$value[9]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[9]['_source']['products_related_diseases']
⇄products_categories => string (16) "Total protein Ab"
$value[9]['_source']['products_categories']
⇄ncbi_full_name => string (55) "HLA class I histocompatibility antigen, A-2 alpha chain"
$value[9]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (44) "major histocompatibility complex, class I, A"
$value[9]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (5) "HLA-A"
$value[9]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (4) "HLAA"
$value[9]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (55) "HLA class I histocompatibility antigen, A-1 alpha chain"
$value[9]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[9]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3105"
$value[9]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "40,922 Da"
$value[9]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (481) "Adaptive Immune System Pathway||1269171!!Allograft Rejection Pathway||920963...
$value[9]['_source']['ncbi_pathways']
Adaptive Immune System Pathway||1269171!!Allograft Rejection Pathway||920963!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Presentation: Folding, Assembly And Peptide Loading Of Class I MHC Pathway||1269194!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Antigen Processing-Cross Presentation Pathway||1269195!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533
⇄sp_protein_name => string (55) "HLA class I histocompatibility antigen, A-2 alpha chain"
$value[9]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (23) "MHC class I antigen A*2"
⇄⧉search_terms => string (997) "aaa29698 rabbit human polyclonal antibodies were purified by affinity purifi...
$value[9]['_source']['search_terms']
aaa29698 rabbit human polyclonal antibodies were purified by affinity purification using immunogen supplied at 1.0mg ml in phosphate buffered saline without mg2+ and ca2+ ph 7.4 150mm nacl 0.02 sodium azide 50 glycerol the antibody detects endogenous level of total hla a protein western blot wb immunohistochemistry ihc immunofluorescence if blotting 1:500 1:2000 1:50 1:100 1:200 analysis extracts various cell lines aaa29698_wb immunohistochemical paraffin embedded endometrial cancer dilution 200x lens aaa29698_ihc2 neurilemmoma aaa29698_ihc3 mouse kidney aaa29698_ihc4 liver aaa29698_ihc5 u2os blue dapi for nuclear staining aaa29698_if6 flj26655 hlaa class i histocompatibility antigen 2 alpha chain major complex 1 40,922 da mhc a*2 1a02_human 122138 p01892.1 p01891 p01892 p04439 p05534 p10314 p10316 p13746 p16189 p18462 p30443 o19619 p06338 p10313 p30444 p30445 p30446 p30514 q29680 q29837 q29899 q95352 142800 ab type recombinant description target name ph7.4 azide50 antigen2 complex1
⇄⧉specificity => string (187) "This assay has high sensitivity and excellent specificity for detection of h...
$value[10]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human HLA-DRA. No significant cross-reactivity or interference between human HLA-DRA and analogues was observed.
⇄purity => string (3) "N/A"
$value[10]['_source']['purity']
⇄form => string (3) "N/A"
$value[10]['_source']['form']
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[10]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[10]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄products_price => string (6) "0.0000"
$value[10]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[10]['_source']['products_weight']
⇄products_status => boolean true
$value[10]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[10]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "700"
$value[10]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[10]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[10]['_source']['language_id']
⇄products_name => string (55) "HLA class II histocompatibility antigen, DR alpha chain"
$value[10]['_source']['products_name']
⇄⧉products_name_oem => string (80) "Human HLA class II histocompatibility antigen, DR alpha chain, HLA-DRA ELISA...
$value[10]['_source']['products_name_oem']
Human HLA class II histocompatibility antigen, DR alpha chain, HLA-DRA ELISA Kit
⇄⧉products_name_syn => string (356) "Human HLA class II histocompatibility antigen; DR alpha chain (HLA-DRA) ELIS...
$value[10]['_source']['products_name_syn']
Human HLA class II histocompatibility antigen; DR alpha chain (HLA-DRA) ELISA kit; DASS-397D15.1; HLA-DRA1; HLA class II histocompatibility antigen; DR alpha chain; MHC cell surface glycoprotein; histocompatibility antigen HLA-DR alpha major histocompatibility complex; class II; DR alpha (HLA-DRA) ; HLA class II histocompatibility antigen; DR alpha chain
⇄products_gene_name => string (7) "HLA-DRA"
$value[10]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[10]['_source']['products_gene_name_syn']
⇄⧉products_description => string (743) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[10]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for HLA-DRA has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any HLA-DRA present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for HLA-DRA is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of HLA-DRA bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[10]['_source']['products_references']
⇄⧉products_related_diseases => string (219) "Nervous System Diseases||72!!Skin Diseases||47!!Multiple Sclerosis||43!!Necr...
⇄ncbi_full_name => string (55) "HLA class II histocompatibility antigen, DR alpha chain"
$value[10]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (52) "major histocompatibility complex, class II, DR alpha"
$value[10]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (7) "HLA-DRA"
$value[10]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (14) "MLRW; HLA-DRA1"
$value[10]['_source']['ncbi_symbol_syn']
⇄⧉ncbi_protein_info => string (153) "HLA class II histocompatibility antigen, DR alpha chain; MHC class II antige...
$value[10]['_source']['ncbi_protein_info']
HLA class II histocompatibility antigen, DR alpha chain; MHC class II antigen DRA; MHC cell surface glycoprotein; histocompatibility antigen HLA-DR alpha
⇄ncbi_chrom_loc => string (3) "N/A"
$value[10]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3122"
$value[10]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (9) "28,607 Da"
$value[10]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (375) "Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!...
$value[10]['_source']['ncbi_pathways']
Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Asthma Pathway||83120!!Asthma Pathway||532!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533
⇄sp_protein_name => string (55) "HLA class II histocompatibility antigen, DR alpha chain"
$value[10]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (24) "MHC class II antigen DRA"
⇄⧉search_terms => string (565) "aaa15886 human this assay has high sensitivity and excellent specificity for...
$value[10]['_source']['search_terms']
aaa15886 human this assay has high sensitivity and excellent specificity for detection of hla dra no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15886_td elisa kit class ii histocompatibility antigen dr alpha chain dass 397d15.1 dra1 mhc cell surface glycoprotein major complex mlrw 28,607 da dra_human 52426774 np_061984.2 p01903 nm_019111.4 q30160 q6iaz1 q861i2 q9tp70 a2bet4 gene 610424 samples serum plasma tissue homogenates type quantitative sandwich range 18.75 pg ml 1200
⇄⧉products_description => string (676) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value[11]['_source']['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is human HLA-C monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄products_references => string (3) "N/A"
$value[11]['_source']['products_references']
⇄⧉products_related_diseases => string (230) "Immune System Diseases||82!!Inflammation||78!!Disease Models, Animal||45!!An...
⇄⧉search_terms => string (589) "aaa12436 human no cross reaction with other factors typical standard curve t...
$value[11]['_source']['search_terms']
aaa12436 human no cross reaction with other factors typical standard curve testing data aaa12436_td elisa kit leukocyte antigen c hla surface cd47 isoform 2 molecule iap oa3 mer6 glycoprotein rh related integrin associated protein signal transducer antigenic determinant identified by monoclonal antibody 1d8 33,845 da cd_antigen cd47_human 38683836 np_942088.1 q08722 nm_198793.2 q53y71 q96a60 a8k198 d3dn59 601028 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 200 u ml 3.12 sensitivity up to 0.6 intra precision isoform2 range200 to0.6
⇄⧉etc_term1 => string (123) "Hybridoma Porduction||Immunogen: Purified membrane of human tonsil cells!!Do...
$value[12]['_source']['etc_term1']
Hybridoma Porduction||Immunogen: Purified membrane of human tonsil cells!!Donor||BALB/c spleen!!Fusion Partner||NS1/1-Ag4.1
⇄⧉etc_term2 => string (179) "Presentation||Purified IgG buffered in PBS and 0.02% NaN3. (Purified from as...
$value[12]['_source']['etc_term2']
Presentation||Purified IgG buffered in PBS and 0.02% NaN3. (Purified from ascitic fluid via Protein G Chromatography). For maximum recovery of contents, spin down tube before use.
⇄⧉products_description => string (263) "anti-human HLA-ABC monoclonal antibody recognizes an epitope common among 43...
$value[12]['_source']['products_description']
anti-human HLA-ABC monoclonal antibody recognizes an epitope common among 43 kDa chains of the HLA-ABC antigens. These antigens appear on virtually every human nucleated cell. This antibody is suitable as a positive control for HLA tissue typing and crossmatching
aaa14273 mouse human monoclonal igg2a w6 32 purified hla abc immunohistochemistry ihc cytotoxic assay ca immunoprecipitation ip flow cytometry complement dependent cytotoxicity and functional assays testing data aaa14273_td antibody anti clone hlk immunogen membrane of tonsil cells donor balb c spleen fusion partner ns1 1 ag4.1 presentation igg buffered in pbs 0.02 nan3 from ascitic fluid via protein g chromatography for maximum recovery contents spin down tube before use w632 ns11
⇄reactivity => string (42) "Human, Mouse, Rat (Expected from Sequence)"
$value[13]['_source']['reactivity']
⇄specificity => string (3) "N/A"
$value[13]['_source']['specificity']
⇄purity => string (48) "Purified whole serum by affinity chromatography."
$value[13]['_source']['purity']
⇄form => string (74) "Liquid in phosphate buffered saline with 0.02% sodium azide, 50% glycerol."
$value[13]['_source']['form']
⇄concentration => string (3) "N/A"
$value[13]['_source']['concentration']
⇄⧉storage_stability => string (322) "Store at -20 degree C.<br>Storage in frost-free freezers is not recommended....
$value[13]['_source']['storage_stability']
Store at -20 degree C.<br>Storage in frost-free freezers is not recommended. This product should be stored undiluted.<br>Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. Shelf Life: 12 months from date of despatch
⇄app_tested => string (54) "Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
⇄⧉testing_protocols => string (944) "IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded human e...
$value[13]['_source']['testing_protocols']
IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded human esophageal tissue using Rabbit anti HLA A antibody at a dilution of 1/100||AAA12255_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human liver injury using Rabbit anti HLA A antibody at a dilution of 1/100||AAA12255_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse liver using Rabbit anti HLA A antibody at a dilution of 1/100||AAA12255_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human esophageal tissue using Rabbit anti HLA A antibody at a dilution of 1/100||AAA12255_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human liver injury using Rabbit anti HLA A antibody at a dilution of 1/100||AAA12255_IHC2.jpg!!WB (Western Blot)||Western blot analysis of cell and tissue lysates using Rabbit anti HLA A antibody||AAA12255_WB.jpg
⇄etc_term1 => string (34) "Immunogen||Recombinant human HLA A"
$value[13]['_source']['etc_term1']
⇄⧉etc_term2 => string (108) "Preperation||Antiserum to HLA A was raised by repeated immunization of rabbi...
$value[13]['_source']['etc_term2']
Preperation||Antiserum to HLA A was raised by repeated immunization of rabbits with highly purified antigen.
⇄products_price => string (6) "0.0000"
$value[13]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[13]['_source']['products_weight']
⇄products_status => boolean true
$value[13]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[13]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "210"
$value[13]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[13]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[13]['_source']['language_id']
⇄products_name => string (5) "HLA A"
$value[13]['_source']['products_name']
⇄products_name_oem => string (17) "Rabbit anti HLA A"
$value[13]['_source']['products_name_oem']
⇄products_name_syn => string (14) "HLA A Antibody"
$value[13]['_source']['products_name_syn']
⇄products_gene_name => string (5) "HLA-A"
$value[13]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[13]['_source']['products_gene_name_syn']
⇄⧉products_description => string (331) "Rabbit anti HLA A antibody recognizes HLA A, also known as HLA class I histo...
$value[13]['_source']['products_description']
Rabbit anti HLA A antibody recognizes HLA A, also known as HLA class I histocompatibility antigen A-1 alpha chain or A-1 alpha chain. HLA A is one of three major types (HLA A, HLA B, HLA C) of human major histocompatability complex class I cell surface receptors. The immune systems uses HLAs to determine self from non-self cells.
⇄products_references => string (3) "N/A"
$value[13]['_source']['products_references']
⇄⧉products_related_diseases => string (223) "Genetic Predisposition to Disease||658!!Liver Diseases||589!!Hepatitis||559!...
⇄⧉storage_stability => string (325) "Store at -20 degree C only. This product should be stored undiluted. Storage...
$value[14]['_source']['storage_stability']
Store at -20 degree C only. This product should be stored undiluted. Storage in frost free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.<br>Shelf Life: 18 months from date of despatch.
⇄⧉app_notes => string (413) "Flow Cytometry: Use 10ul of the suggested working dilution to label 106 cell...
$value[14]['_source']['app_notes']
Flow Cytometry: Use 10ul of the suggested working dilution to label 106 cells or 100ul whole blood <br><b>Immunohistology - Frozen: </b>Application Note: <b>The epitope recognised by this antibody is reported to be sensitive to formaldehyde fixation and tissue processing. We recommends the use of acetone fixation for frozen sections.</b><br><b>Flow Cytometry: </b>Minimum Dilution: 1/50; Maximum Dilution: 1/100
⇄⧉testing_protocols => string (738) "Application Data||Staining of human peripheral blood lymphocytes with Mouse ...
$value[14]['_source']['testing_protocols']
Application Data||Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC:Alexa Fluor 647||AAA11910_APP6.gif!!Application Data||Staining of human peripheral blood monocytes with Mouse anti Human HLA ABC:Biotin||AAA11910_APP5.gif!!Application Data||Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC||AAA11910_APP4.gif!!Application Data||Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC:Alexa Fluor 488||AAA11910_APP3.gif!!Application Data||Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC:FITC||AAA11910_APP2.gif!!Application Data||Staining of peripheral blood lymphocytes with Mouse anti Human HLA-ABC: Low Endotoxin||AAA11910_APP.jpg
⇄⧉etc_term1 => string (106) "Preparation||Purified IgG prepared by affinity chromatography on Protein G f...
$value[14]['_source']['etc_term1']
Preparation||Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant
⇄⧉etc_term2 => string (294) "Immunogen||Purified human tonsil lymphocyte membranes.<br>Histology Positive...
$value[14]['_source']['etc_term2']
Immunogen||Purified human tonsil lymphocyte membranes.<br>Histology Positive Control Tissue||Tonsil<br>Fusion Partners||Spleen cells from immunised BALB/c mice were fused with cells of the mouse NS1/1-Ag4.1 myeloma cell line.<br>Buffer Solution||Phosphate buffered saline!!Target Species||Human
⇄products_price => string (6) "0.0000"
$value[14]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[14]['_source']['products_weight']
⇄products_status => boolean true
$value[14]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[14]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "210"
$value[14]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[14]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[14]['_source']['language_id']
⇄products_name => string (7) "HLA ABC"
$value[14]['_source']['products_name']
⇄products_name_oem => string (38) "MOUSE ANTI HUMAN HLA ABC:Low Endotoxin"
$value[14]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[14]['_source']['products_name_syn']
⇄products_gene_name => string (7) "HLA ABC"
$value[14]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[14]['_source']['products_gene_name_syn']
⇄⧉products_description => string (735) "Mouse anti Human HLA ABC antibody, clone W6/32 recognizes an antigenic deter...
$value[14]['_source']['products_description']
Mouse anti Human HLA ABC antibody, clone W6/32 recognizes an antigenic determinant shared among products of the HLA A, B and C loci. Clone W6/32 recognizes a conformational epitope, reacting with HLA class I alpha3 and alpha2 domains. The major histocompatibility complex (MHC) is a cluster of genes that are important in the immune response to infections. In humans, this complex is referred to as the human leukocyte antigen (HLA) region. There are 3 major MHC class I proteins encoded by the HLA which are HLA A, HLA B and HLA C. These proteins are found on the surface of almost all nucleated somatic cells. Mouse anti Human HLA ABC antibody, clone W6/32 is routinely tested in flow cytometry on human peripheral blood lymphocytes.
aaa11910 mouse monoclonal igg2a w6 32 low endotoxin purified igg liquid immunohistology frozen* elisa eia flow cytometry fc facs functional assays fn immunofluorescence if immunoprecipitation ip use 10ul of the suggested working dilution to label 106 cells or 100ul whole blood frozen application note epitope recognised by this antibody is reported be sensitive formaldehyde fixation and tissue processing mybiosource recommends acetone for sections minimum 1 50 maximum 100 testing data staining peripheral lymphocytes with anti human hla abc aaa11910_td abc:fitc mbs211107 aaa11910_td1 abc:alexa fluor 488 mbs213169a488 aaa11910_td2 mbs213169 aaa11910_td3 monocytes abc:biotin mbs210522 aaa11910_td4 647 mbs213169a647 aaa11910_td5 abc:low preparation prepared affinity chromatography on protein g from culture supernatant immunogen tonsil lymphocyte membranes histology positive control fusion partners spleen immunised balb c mice were fused ns1 ag4.1 myeloma cell line buffer solution phosphate buffered saline target species w632 label106 minimum1 maximum100 fluor488 aaa11910_td4647
⇄concentration => string (73) "Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml."
$value[15]['_source']['concentration']
⇄⧉storage_stability => string (220) "Store at -20 degree C for one year from date of receipt. After reconstitutio...
$value[15]['_source']['storage_stability']
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.
WB: 0.25-0.5 ug/ml, Human<br>IHC-P: 2-5 ug/ml, Human<br>FC/FACS: 1-3 ug/1x10^6 cells, Human<br>Tested Species: In-house tested species with positive results.<br>Enhanced Chemiluminescent Kit with anti- IgG for Western blot, and HRP Conjugated anti- IgG Super Vision Assay Kit for IHC(P).
FCM (Flow Cytometry)||Figure 7. Flow Cytometry analysis of Daudi cells using anti-HLA-DRA antibody (AAA19681).<br><br>Overlay histogram showing Daudi cells stained with AAA19681 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-HLA-DRA Antibody (AAA19681, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.||AAA19681_FCM7.jpg!!IHC (Immunohistchemistry)||Figure 6. IHC analysis of HLA-DRA using anti-HLA-DRA antibody (AAA19681).<br><br>HLA-DRA was detected in a paraffin-embedded section of human bladder epithelial carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-HLA-DRA Antibody (AAA19681) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.||AAA19681_IHC6.jpg!!IHC (Immunohistochemistry)||Figure 5. IHC analysis of HLA-DRA using anti-HLA-DRA antibody (AAA19681).<br><br>HLA-DRA was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-HLA-DRA Antibody (AAA19681) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.||AAA19681_IHC5.jpg!!IHC (Immunohistochemistry)||Figure 4. IHC analysis of HLA-DRA using anti-HLA-DRA antibody (AAA19681).<br><br>HLA-DRA was detected in a paraffin-embedded section of human hepatocellular carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-HLA-DRA Antibody (AAA19681) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.||AAA19681_IHC4.jpg!!IHC (Immunohistochemistry)||Figure 3. IHC analysis of HLA-DRA using anti-HLA-DRA antibody (AAA19681).<br><br>HLA-DRA was detected in a paraffin-embedded section of human endometrial cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-HLA-DRA Antibody (AAA19681) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.||AAA19681_IHC3.jpg!!IHC (Immunohistochemistry)||Figure 2. IHC analysis of HLA-DRA using anti-HLA-DRA antibody (AAA19681).<br><br>HLA-DRA was detected in a paraffin-embedded section of human colonic adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/ml mouse anti-HLA-DRA Antibody (AAA19681) overnight at 4 degree C. Peroxidase Conjugated Goat Anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using HRP Conjugated Mouse IgG Super Vision Assay Kit with DAB as the chromogen.||AAA19681_IHC2.jpg!!WB (Western Blot)||Figure 1. Western blot analysis of HLA-DRA using anti-HLA-DRA antibody (AAA19681).<br><br>Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.<br><br>Lane 1: human Raji whole cell lysates,<br>Lane 2: human Daudi whole cell lysates.<br><br>After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-HLA-DRA antigen affinity purified monoclonal antibody (#AAA19681) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for HLA-DRA at approximately 35-37 kDa. The expected band size for HLA-DRA is at 29 kDa.||AAA19681_WB.jpg
⇄⧉etc_term1 => string (89) "Reconstitution||Adding 0.2 ml of distilled water will yield a concentration ...
$value[15]['_source']['etc_term1']
Reconstitution||Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
⇄⧉etc_term2 => string (88) "Immunogen||E Coli-derived human HLA-DR/HLA-DRA recombinant protein (Position...
$value[15]['_source']['etc_term2']
Immunogen||E Coli-derived human HLA-DR/HLA-DRA recombinant protein (Position: I26-L254).
⇄⧉products_description => string (880) "HLA class II histocompatibility antigen, DR alpha chainis aproteinthat in hu...
$value[15]['_source']['products_description']
HLA class II histocompatibility antigen, DR alpha chainis aproteinthat in humans is encoded by the HLA-DRAgene. It is mapped to 6p21.32. HLA-DRA is one of the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha and a beta chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. DRA does not have polymorphisms in the peptide binding part and acts as the sole alpha chain for DRB1, DRB3, DRB4 and DRB5.
⇄products_references => string (3) "N/A"
$value[15]['_source']['products_references']
⇄⧉products_related_diseases => string (219) "Nervous System Diseases||75!!Skin Diseases||47!!Multiple Sclerosis||44!!Necr...
⇄ncbi_full_name => string (55) "HLA class II histocompatibility antigen, DR alpha chain"
$value[15]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (52) "major histocompatibility complex, class II, DR alpha"
$value[15]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (7) "HLA-DRA"
$value[15]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (14) "MLRW; HLA-DRA1"
$value[15]['_source']['ncbi_symbol_syn']
⇄⧉ncbi_protein_info => string (153) "HLA class II histocompatibility antigen, DR alpha chain; MHC class II antige...
$value[15]['_source']['ncbi_protein_info']
HLA class II histocompatibility antigen, DR alpha chain; MHC class II antigen DRA; MHC cell surface glycoprotein; histocompatibility antigen HLA-DR alpha
⇄ncbi_chrom_loc => string (3) "N/A"
$value[15]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3122"
$value[15]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "254"
$value[15]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (375) "Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!...
$value[15]['_source']['ncbi_pathways']
Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Asthma Pathway||83120!!Asthma Pathway||532!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533
⇄sp_protein_name => string (55) "HLA class II histocompatibility antigen, DR alpha chain"
$value[15]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (24) "MHC class II antigen DRA"
⇄form => string (64) "Purified IgG conjugated to R. Phycoerythrin (RPE) - lyophilised."
$value[16]['_source']['form']
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄⧉storage_stability => string (354) "Prior to reconstitution store at 4 degree C. Following reconstitution store ...
$value[16]['_source']['storage_stability']
Prior to reconstitution store at 4 degree C. Following reconstitution store at 4 degree C. DO NOT FREEZE. This product should be stored undiluted. This product is photosensitive and should be protected from light. Should this product contain a precipitate we recommend microcentrifugation before use.<br>Shelf Life: 12 months from date of reconstitution.
⇄⧉app_notes => string (149) "Flow Cytometry: Use 10ul of the suggested working dilution to label 106 cell...
$value[16]['_source']['app_notes']
Flow Cytometry: Use 10ul of the suggested working dilution to label 106 cells or 100ul whole blood. <br><b>Flow Cytometry: </b>Maximum Dilution: Neat
⇄⧉testing_protocols => string (738) "Application Data||Staining of human peripheral blood lymphocytes with Mouse ...
$value[16]['_source']['testing_protocols']
Application Data||Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC:Alexa Fluor 647||AAA12059_APP6.gif!!Application Data||Staining of human peripheral blood monocytes with Mouse anti Human HLA ABC:Biotin||AAA12059_APP5.gif!!Application Data||Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC||AAA12059_APP4.gif!!Application Data||Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC:Alexa Fluor 488||AAA12059_APP3.gif!!Application Data||Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC:FITC||AAA12059_APP2.gif!!Application Data||Staining of peripheral blood lymphocytes with Mouse anti Human HLA-ABC: Low Endotoxin||AAA12059_APP.jpg
⇄⧉etc_term1 => string (254) "Reconstitution||Reconstitute with 1ml distilled water.<br>Perservative Stabi...
$value[16]['_source']['etc_term1']
Reconstitution||Reconstitute with 1ml distilled water.<br>Perservative Stabilisers||0.09% Sodium Azide<br>1% Bovine Serum Albumin<br>5% Sucrose<br>Preparation||Purified IgG prepared by affinity chromatography on Protein G from tissue culture supernatant.
⇄⧉etc_term2 => string (251) "Immunogen||Purified human tonsil lymphocyte membranes.<br>Fusion Partners||S...
$value[16]['_source']['etc_term2']
Immunogen||Purified human tonsil lymphocyte membranes.<br>Fusion Partners||Spleen cells from immunised BALB/c mice were fused with cells of the NS1/1 - Ag4.1 mouse myeloma cell line.<br>Buffer Solution||Phosphate buffered saline!!Target Species||Human
⇄products_price => string (6) "0.0000"
$value[16]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[16]['_source']['products_weight']
⇄products_status => boolean true
$value[16]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[16]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "210"
$value[16]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[16]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[16]['_source']['language_id']
⇄products_name => string (7) "HLA ABC"
$value[16]['_source']['products_name']
⇄products_name_oem => string (28) "MOUSE ANTI HUMAN HLA ABC:RPE"
$value[16]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[16]['_source']['products_name_syn']
⇄products_gene_name => string (7) "HLA ABC"
$value[16]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[16]['_source']['products_gene_name_syn']
⇄⧉products_description => string (735) "Mouse anti Human HLA ABC antibody, clone W6/32 recognizes an antigenic deter...
$value[16]['_source']['products_description']
Mouse anti Human HLA ABC antibody, clone W6/32 recognizes an antigenic determinant shared among products of the HLA A, B and C loci. Clone W6/32 recognizes a conformational epitope, reacting with HLA class I alpha3 and alpha2 domains. The major histocompatibility complex (MHC) is a cluster of genes that are important in the immune response to infections. In humans, this complex is referred to as the human leukocyte antigen (HLA) region. There are 3 major MHC class I proteins encoded by the HLA which are HLA A, HLA B and HLA C. These proteins are found on the surface of almost all nucleated somatic cells. Mouse anti Human HLA ABC antibody, clone W6/32 is routinely tested in flow cytometry on human peripheral blood lymphocytes.
WB: 1:1000-1:6000<br>IHC-P: 1:200-1:2000<br>ELISA: Recommended starting concentration is 1ug/mL.<br>Please optimize the concentration based on your specific assay requirements.
⇄⧉testing_protocols => string (2124) "IHC (Immunohistochemistry)||Immunohistochemistry analysis of paraffin-embedd...
$value[17]['_source']['testing_protocols']
IHC (Immunohistochemistry)||Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using HLA-DQA1 Rabbit mAb (AAA28454) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.||AAA28454_IHC7.jpg!!IHC (Immunohistchemistry)||Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using HLA-DQA1 Rabbit mAb (AAA28454) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.||AAA28454_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using HLA-DQA1 Rabbit mAb (AAA28454) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.||AAA28454_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using HLA-DQA1 Rabbit mAb (AAA28454) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.||AAA28454_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry analysis of paraffin-embedded Human liver tissue using HLA-DQA1 Rabbit mAb (AAA28454) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.||AAA28454_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry analysis of paraffin-embedded Human colon tissue using HLA-DQA1 Rabbit mAb (AAA28454) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.||AAA28454_IHC2.jpg!!WB (Western Blot)||Western blot analysis of various lysates using HLA-DQA1 Rabbit mAb (AAA28454) at 1?1000 dilution.<br/>Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.<br/>Lysates/proteins: 25ug per lane.<br/>Blocking buffer: 3% nonfat dry milk in TBST.<br/>Detection: ECL Basic Kit (RM00020).<br/>Exposure time: 10s.||AAA28454_WB.jpg
⇄⧉products_description => string (890) "HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II mo...
$value[17]['_source']['products_description']
HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation.
⇄products_references => string (3) "N/A"
$value[17]['_source']['products_references']
⇄⧉products_related_diseases => string (224) "Immune System Diseases||539!!Gastrointestinal Diseases||138!!Nervous System ...
Immune System Diseases||539!!Gastrointestinal Diseases||138!!Nervous System Diseases||122!!Celiac Disease||120!!Kidney Diseases||44!!Liver Diseases||38!!Necrosis||37!!Lung Diseases||33!!Hypersensitivity||28!!Inflammation||27
⇄⧉products_description => string (827) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[18]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Human HLA-G monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (537) "aaa12952 human typical testing data standard curve for reference only aaa129...
$value[18]['_source']['search_terms']
aaa12952 human typical testing data standard curve for reference only aaa12952_sc elisa kit leukocyte antigen g hla a2 variant partial major histocompatibility complex class i a hlaa 1 alpha chain presenting molecule mhc heavy 29,434 da o02922_human 2117163 caa73716.1 p01891 p01892 p04439 p05534 p10314 p10316 p13746 p16189 p18462 p30443 o02922 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 20 ng ml 0.312 sensitivity up to 0.06 intra precision <= 8 inter 12 hlaa1 range20 <=8 inter12
⇄⧉testing_protocols => string (1354) "IF (Immunofluorescence)||Immunofluorescence analysis of NIH/3T3 cells using ...
$value[19]['_source']['testing_protocols']
IF (Immunofluorescence)||Immunofluorescence analysis of NIH/3T3 cells using HLA-DPB1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28352_IF7.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of HeLa cells using HLA-DPB1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28352_IF6.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of C6 cells using HLA-DPB1 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28352_IF5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded Rat spleen using HLA-DPB1 antibody at dilution of 1:100 (40x lens).||AAA28352_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded Mouse spleen using HLA-DPB1 antibody at dilution of 1:100 (40x lens).||AAA28352_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded Human liver cancer using HLA-DPB1 antibody at dilution of 1:100 (40x lens).||AAA28352_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using HLA-DPB1 antibody at 1:1000 dilution.<br />Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.<br />Lysates/proteins: 25ug per lane.<br />Blocking buffer: 3% nonfat dry milk in TBST.<br />Detection: ECL Basic Kit (RM00020).<br />Exposure time: 1s.||AAA28352_WB.jpg
⇄⧉etc_term1 => string (316) "Immunogen||Recombinant fusion protein of Human HLA-DPB1.!!Cellular Location|...
$value[19]['_source']['etc_term1']
Immunogen||Recombinant fusion protein of Human HLA-DPB1.!!Cellular Location||Cell membrane, Endoplasmic reticulum membrane, Endosome membrane, Golgi apparatus, Lysosome membrane, Single-pass type I membrane protein, trans-Golgi network membrane!!Positive Samples||U-937, A-549, Mouse spleen, Mouse thymus, Rat thymus
DPB1; HLA-DP; HLA-DP1B; HLA-DPB; HLA-DPB1; major histocompatibility complex; class II; DP beta 1
⇄products_gene_name => string (8) "HLA-DPB1"
$value[19]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[19]['_source']['products_gene_name_syn']
⇄⧉products_description => string (863) "Background: HLA-DPB belongs to the HLA class II beta chain paralogues. This ...
$value[19]['_source']['products_description']
Background: HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. [provided by RefSeq, Jul 2008]
⇄products_references => string (3) "N/A"
$value[19]['_source']['products_references']
⇄⧉products_related_diseases => string (210) "Lung Diseases, Interstitial||54!!Nervous System Diseases||50!!Berylliosis||3...
⇄⧉ncbi_protein_info => string (255) "HLA class II histocompatibility antigen, DP beta 1 chain; MHC HLA DPB1; HLA ...
$value[19]['_source']['ncbi_protein_info']
HLA class II histocompatibility antigen, DP beta 1 chain; MHC HLA DPB1; HLA DP14-beta chain; MHC class II HLA-DRB1; class II HLA beta chain; MHC class II antigen DPB1; MHC class II HLA-DP-beta-1; MHC class II antigen DPbeta1; MHC class II antigen beta cha
⇄ncbi_chrom_loc => string (3) "N/A"
$value[19]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (4) "3115"
$value[19]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "258"
$value[19]['_source']['ncbi_mol_weight']
⇄⧉ncbi_pathways => string (375) "Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!...
$value[19]['_source']['ncbi_pathways']
Adaptive Immune System Pathway||366160!!Allograft Rejection Pathway||920963!!Allograft Rejection Pathway||83123!!Allograft Rejection Pathway||535!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Asthma Pathway||83120!!Asthma Pathway||532!!Autoimmune Thyroid Disease Pathway||83121!!Autoimmune Thyroid Disease Pathway||533
⇄sp_protein_name => string (56) "HLA class II histocompatibility antigen, DP beta 1 chain"
$value[19]['_source']['sp_protein_name']
⇄⧉sp_protein_name_syn => string (85) "HLA class II histocompatibility antigen, DP(W4) beta chain; MHC class II ant...
$value[19]['_source']['sp_protein_name_syn']
HLA class II histocompatibility antigen, DP(W4) beta chain; MHC class II antigen DPB1
