Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse SC4MOL Polyclonal Antibody | anti-SC4MOL antibody

SC4MOL antibody

Gene Names
MSMO1; DESP4; ERG25; SC4MOL
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
SC4MOL; Polyclonal Antibody; SC4MOL antibody; Polyclonal SC4MOL; Anti-SC4MOL; SCMOL-4; Sterol-C4-Methyl Oxidase-Like; SCMOL 4; MGC104344; ERG25; DESP4; anti-SC4MOL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Specificity
SC4MOL antibody was raised against the N terminal of SC4MOL
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SC4MOL antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
293
Applicable Applications for anti-SC4MOL antibody
Western Blot (WB)
Application Notes
WB: 5 ug/ml
Biological Significance
Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.
Cross-Reactivity
Human,Mouse
Immunogen
SC4MOL antibody was raised using the N terminal of SC4MOL corresponding to a region with amino acids MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-SC4MOL antibody
Rabbit polyclonal SC4MOL antibody raised against the N terminal of SC4MOL
Product Categories/Family for anti-SC4MOL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
35 kDa (MW of target protein)
NCBI Official Full Name
sterol-C4-methyl oxidase-like, isoform CRA_a
NCBI Official Synonym Full Names
methylsterol monooxygenase 1
NCBI Official Symbol
MSMO1
NCBI Official Synonym Symbols
DESP4; ERG25; SC4MOL
NCBI Protein Information
methylsterol monooxygenase 1
UniProt Protein Name
Methylsterol monooxygenase 1
UniProt Gene Name
MSMO1
UniProt Synonym Gene Names
DESP4; ERG25; SC4MOL
UniProt Entry Name
MSMO1_HUMAN

NCBI Description

Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to function in cholesterol biosynthesis. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SC4MOL: Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to function in cholesterol biosynthesis. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Protein type: Oxidoreductase; Endoplasmic reticulum; EC 1.14.13.72; Membrane protein, multi-pass; Lipid Metabolism - steroid biosynthesis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q32-q34

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; plasma membrane; integral to membrane

Molecular Function: C-4 methylsterol oxidase activity; iron ion binding

Biological Process: steroid metabolic process; fatty acid metabolic process; cholesterol biosynthetic process; fatty acid biosynthetic process

Research Articles on SC4MOL

Similar Products

Product Notes

The SC4MOL msmo1 (Catalog #AAA839658) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SC4MOL antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SC4MOL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 5 ug/ml. Researchers should empirically determine the suitability of the SC4MOL msmo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SC4MOL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.