Western Blot (WB)
(Host: RabbitTarget Name: SAR1BSample Type: Human ThyroidLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)
Rabbit SAR1A Polyclonal Antibody | anti-SAR1A antibody
SAR1A Antibody - middle region
Gene Names
SAR1A; SAR1; Sara; SARA1; masra2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SAR1A; Polyclonal Antibody; SAR1A Antibody - middle region; anti-SAR1A antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AISEERLREMFGLYGQTTGKGSVSLKELNARPLGVFMCSVLKRQGYGEGF
Sequence Length
198
Applicable Applications for anti-SAR1A antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 93%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse SAR1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SAR1BSample Type: Human ThyroidLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)
Western Blot (WB)
(Host: RabbitTarget Name: SAR1BSample Type: Human ThyroidLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)
Western Blot (WB)
(Host: RabbitTarget Name: Sar1bSample Type: Mouse Stomach lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Sar1bSample Type: Mouse Stomach lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SAR1A antibody
This is a rabbit polyclonal antibody against Sar1b. It was validated on Western Blot
Product Categories/Family for anti-SAR1A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
GTP-binding protein SAR1a
NCBI Official Synonym Full Names
secretion associated Ras related GTPase 1A
NCBI Official Symbol
SAR1A
NCBI Official Synonym Symbols
SAR1; Sara; SARA1; masra2
NCBI Protein Information
GTP-binding protein SAR1a
UniProt Protein Name
GTP-binding protein SAR1a
Protein Family
UniProt Gene Name
SAR1A
UniProt Synonym Gene Names
SAR1; SARA; SARA1
UniProt Entry Name
SAR1A_HUMAN
Uniprot Description
SAR1A: Involved in transport from the endoplasmic reticulum to the Golgi apparatus. Required to maintain SEC16A localization at discrete locations on the ER membrane perhaps by preventing its dissociation. SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining endoplasmic reticulum exit sites (ERES). Belongs to the small GTPase superfamily. SAR1 family.
Protein type: G protein, monomeric; G protein, monomeric, SAR1; G protein
Chromosomal Location of Human Ortholog: 10q22.1
Cellular Component: Golgi apparatus; sarcoplasmic reticulum
Molecular Function: GTP binding
Biological Process: vesicle-mediated transport; intracellular protein transport
Research Articles on SAR1A
Similar Products
Product Notes
The SAR1A sar1a (Catalog #AAA3212653) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAR1A Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SAR1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SAR1A sar1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AISEERLREM FGLYGQTTGK GSVSLKELNA RPLGVFMCSV LKRQGYGEGF. It is sometimes possible for the material contained within the vial of "SAR1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
