Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SAE1Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SAE1 Polyclonal Antibody | anti-SAE1 antibody

SAE1 Antibody - middle region

Gene Names
SAE1; AOS1; SUA1; UBLE1A; HSPC140
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SAE1; Polyclonal Antibody; SAE1 Antibody - middle region; anti-SAE1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDS
Sequence Length
346
Applicable Applications for anti-SAE1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SAE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SAE1Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SAE1Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SAE1 antibody
Posttranslational modification of proteins by the addition of the small protein SUMO, or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins.
Product Categories/Family for anti-SAE1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
SUMO-activating enzyme subunit 1 isoform b
NCBI Official Synonym Full Names
SUMO1 activating enzyme subunit 1
NCBI Official Symbol
SAE1
NCBI Official Synonym Symbols
AOS1; SUA1; UBLE1A; HSPC140
NCBI Protein Information
SUMO-activating enzyme subunit 1
UniProt Protein Name
SUMO-activating enzyme subunit 1
Protein Family
UniProt Gene Name
SAE1
UniProt Synonym Gene Names
AOS1; SUA1; UBLE1A
UniProt Entry Name
SAE1_HUMAN

NCBI Description

Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).[supplied by OMIM, Mar 2010]

Uniprot Description

UBLE1A: The heterodimer acts as a E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2. Belongs to the ubiquitin-activating E1 family.

Protein type: EC 6.3.2.19; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 19q13.32

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytosol; nucleus

Molecular Function: protein C-terminus binding; ATP-dependent protein binding; SUMO activating enzyme activity; protein binding; protein heterodimerization activity; enzyme activator activity; ubiquitin activating enzyme activity

Biological Process: positive regulation of catalytic activity; cellular protein metabolic process; protein sumoylation; regulation of mitotic cell cycle; protein ubiquitination; SMT3-dependent protein catabolic process; post-translational protein modification

Research Articles on SAE1

Similar Products

Product Notes

The SAE1 sae1 (Catalog #AAA3221787) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAE1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SAE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SAE1 sae1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KEALEVDWSS EKAKAALKRT TSDYFLLQVL LKFRTDKGRD PSSDTYEEDS. It is sometimes possible for the material contained within the vial of "SAE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.