Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: S1PR1Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human S1PR1 Polyclonal Antibody | anti-S1PR1 antibody

S1PR1 Antibody - C-terminal region

Gene Names
S1PR1; EDG1; S1P1; CD363; ECGF1; EDG-1; CHEDG1; D1S3362
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
S1PR1; Polyclonal Antibody; S1PR1 Antibody - C-terminal region; anti-S1PR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVN
Sequence Length
382
Applicable Applications for anti-S1PR1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human S1PR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: S1PR1Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: S1PR1Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-S1PR1 antibody
The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42 kDa
NCBI Official Full Name
sphingosine 1-phosphate receptor 1
NCBI Official Synonym Full Names
sphingosine-1-phosphate receptor 1
NCBI Official Symbol
S1PR1
NCBI Official Synonym Symbols
EDG1; S1P1; CD363; ECGF1; EDG-1; CHEDG1; D1S3362
NCBI Protein Information
sphingosine 1-phosphate receptor 1
UniProt Protein Name
Sphingosine 1-phosphate receptor 1
UniProt Gene Name
S1PR1
UniProt Synonym Gene Names
CHEDG1; EDG1; S1P receptor 1; S1P1
UniProt Entry Name
S1PR1_HUMAN

NCBI Description

The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Uniprot Description

EDG-1: a G protein-coupled receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. Highly expressed in endothelial cells and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin. Suggested to be involved in the processes that regulate the migration/differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. S1P-induced endothelial cell migration requires AKT1-mediated phosphorylation of the third intracellular loop. Seems to be coupled to the G(i) subclass of heteromeric G proteins.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1p21

Cellular Component: plasma membrane; integral to membrane; intrinsic to plasma membrane; endosome; external side of plasma membrane; lipid raft

Molecular Function: G-protein coupled receptor activity; sphingolipid binding; G-protein-coupled receptor binding

Biological Process: lamellipodium biogenesis; regulation of cell adhesion; endothelial cell differentiation; regulation of bone resorption; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); cell migration; negative regulation of stress fiber formation; positive regulation of positive chemotaxis; positive regulation of smooth muscle cell proliferation; transmission of nerve impulse; chemotaxis; blood vessel maturation; neuron differentiation; G-protein coupled receptor protein signaling pathway; actin cytoskeleton reorganization; positive regulation of transcription from RNA polymerase II promoter; G-protein signaling, adenylate cyclase inhibiting pathway; brain development; angiogenesis; cell adhesion; regulation of bone mineralization; positive regulation of cell migration

Research Articles on S1PR1

Similar Products

Product Notes

The S1PR1 s1pr1 (Catalog #AAA3221546) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The S1PR1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's S1PR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the S1PR1 s1pr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KCPSGDSAGK FKRPIIAGME FSRSKSDNSS HPQKDEGDNP ETIMSSGNVN. It is sometimes possible for the material contained within the vial of "S1PR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.