Western Blot (WB)
(Host: RabbitTarget Name: Runx1Sample Type: Mouse Skeletal Muscle lysatesAntibody Dilution: 1.0ug/ml)
Rabbit Runx1 Polyclonal Antibody | anti-RUNX1 antibody
Runx1 Antibody - N-terminal region
Gene Names
Runx1; AML1; Cbfa2; Pebp2a2; Pebpa2b; CBF-alpha-2
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Runx1; Polyclonal Antibody; Runx1 Antibody - N-terminal region; anti-RUNX1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KMSEALPLGAPDGGPALASKLRSGDRSMVEVLADHPGELVRTDSPNFLCS
Sequence Length
387
Applicable Applications for anti-RUNX1 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 79%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Runx1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Runx1Sample Type: Mouse Skeletal Muscle lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Runx1Sample Type: Mouse Skeletal Muscle lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RUNX1 antibody
This is a rabbit polyclonal antibody against Runx1. It was validated on Western Blot
Target Description: CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. Runx1 is essential for the development of normal hematopoiesis. Isoform 4 shows higher binding activities for target genes and binds TCR-beta-E2 and RAG-1 target site with threefold higher affinity than other isoforms. It is less effective in the context of neutrophil terminal differentiation. Runx1 acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the BLK promoter. It inhibits KAT6B-dependent transcriptional activation .
Target Description: CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. Runx1 is essential for the development of normal hematopoiesis. Isoform 4 shows higher binding activities for target genes and binds TCR-beta-E2 and RAG-1 target site with threefold higher affinity than other isoforms. It is less effective in the context of neutrophil terminal differentiation. Runx1 acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the BLK promoter. It inhibits KAT6B-dependent transcriptional activation .
Product Categories/Family for anti-RUNX1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
runt-related transcription factor 1 isoform 4
NCBI Official Synonym Full Names
runt related transcription factor 1
NCBI Official Symbol
Runx1
NCBI Official Synonym Symbols
AML1; Cbfa2; Pebp2a2; Pebpa2b; CBF-alpha-2
NCBI Protein Information
runt-related transcription factor 1
UniProt Protein Name
Runt-related transcription factor 1
Protein Family
UniProt Gene Name
Runx1
UniProt Synonym Gene Names
Aml1; Cbfa2; Pebp2ab; CBF-alpha-2; PEA2-alpha B; PEBP2-alpha B
UniProt Entry Name
RUNX1_MOUSE
Research Articles on RUNX1
Similar Products
Product Notes
The RUNX1 runx1 (Catalog #AAA3203800) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Runx1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Runx1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RUNX1 runx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KMSEALPLGA PDGGPALASK LRSGDRSMVE VLADHPGELV RTDSPNFLCS. It is sometimes possible for the material contained within the vial of "Runx1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
