Rabbit anti-Mouse RUBCN Polyclonal Antibody | anti-RUBCN antibody

RUBCN Polyclonal Antibody

Cat. Num. AAA9133217

• Gene Names: RUBCN; SCAR15; RUBICON; KIAA0226
• Reactivity: Mouse
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: RUBCN; Polyclonal Antibody; RUBCN Polyclonal Antibody; KIAA0226; RUBICON; SCAR15; anti-RUBCN antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: MRPEGAGMELGGGEERLPEESRREHWQLLGNLKTTVEGLVSTNSPNVWSKYGGLERLCRDMQSILYHGLIRDQACRRQTDYWQFVKDIRWLSPHSALHVEKFISVHENDQSSADGASERAVAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLL
• Sequence Length: 927

• Applicable Applications for anti-RUBCN antibody: Western Blot (WB)
• Application Notes: WB: 1:500 - 1:2000
• Immunogen: Recombinant protein of human RUBCN
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Early endosome, Late endosome, Lysosome
• Positive Samples: Mouse brain
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of mouse brain, using RUBCN antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

Related Product Information for anti-RUBCN antibody

The protein encoded by this gene is a negative regulator of autophagy and endocytic trafficking and controls endosome maturation. This protein contains two conserved domains, an N-terminal RUN domain and a C-terminal DUF4206 domain. The RUN domain is involved in Ras-like GTPase signaling, and the DUF4206 domain contains a diacylglycerol (DAG) binding-like motif. Mutation in this gene results in deletion of the DAG binding-like motif and causes a recessive ataxia. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Product Categories/Family for anti-RUBCN antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 224548938
• NCBI GeneID: 9711
• NCBI Accession #: NP_001139114.1
• NCBI GenBank Nucleotide #: NM_001145642.4
• UniProt Accession #: Q92622; Q96CK5
• Molecular Weight: Calculated: 102kDa; 103kDa; 108kDa; Observed: 108kDa
• NCBI Official Full Name: run domain Beclin-1-interacting and cysteine-rich domain-containing protein isoform 1
• NCBI Official Synonym Full Names: RUN and cysteine rich domain containing beclin 1 interacting protein
• NCBI Official Symbol: RUBCN
• NCBI Official Synonym Symbols: SCAR15; RUBICON; KIAA0226
• NCBI Protein Information: run domain Beclin-1-interacting and cysteine-rich domain-containing protein
• UniProt Protein Name: Run domain Beclin-1-interacting and cysteine-rich domain-containing protein
• Protein Family: Run domain Beclin-1-interacting and cysteine-rich domain-containing protein
• UniProt Gene Name: RUBCN
• UniProt Synonym Gene Names: Rubicon; Baron

NCBI Description

The protein encoded by this gene is a negative regulator of autophagy and endocytic trafficking and controls endosome maturation. This protein contains two conserved domains, an N-terminal RUN domain and a C-terminal DUF4206 domain. The RUN domain is involved in Ras-like GTPase signaling, and the DUF4206 domain contains a diacylglycerol (DAG) binding-like motif. Mutation in this gene results in deletion of the DAG binding-like motif and causes a recessive ataxia. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Apr 2014]

Uniprot Description

Inhibits PIK3C3 activity; under basal conditions negatively regulates PI3K complex II (PI3KC3-C2) function in autophagy. Negatively regulates endosome maturation and degradative endocytic trafficking and impairs autophagosome maturation process. Can sequester UVRAG from association with a class C Vps complex (possibly the HOPS complex) and negatively regulates Rab7 activation (PubMed:20974968, PubMed:21062745).