Western Blot (WB)
(WB Suggested Anti-C1orf63 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateC1orf63 is supported by BioGPS gene expression data to be expressed in HepG2)
Rabbit anti-Human RSRP1 Polyclonal Antibody | anti-RSRP1 antibody
RSRP1 Antibody - C-terminal region
Gene Names
RSRP1; NPD014; C1orf63
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RSRP1; Polyclonal Antibody; RSRP1 Antibody - C-terminal region; anti-RSRP1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PTQQRSIAFSSNNSVAKPIQKSAKAATEEASSRSPKIDQKKSPYGLWIPI
Sequence Length
290
Applicable Applications for anti-RSRP1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human C1orf63
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-C1orf63 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateC1orf63 is supported by BioGPS gene expression data to be expressed in HepG2)
Western Blot (WB)
(WB Suggested Anti-C1orf63 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateC1orf63 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-RSRP1 antibody
This is a rabbit polyclonal antibody against C1orf63. It was validated on Western Blot using a cell lysate as a positive control.
Product Categories/Family for anti-RSRP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
arginine/serine-rich protein 1
NCBI Official Synonym Full Names
arginine and serine rich protein 1
NCBI Official Symbol
RSRP1
NCBI Official Synonym Symbols
NPD014; C1orf63
NCBI Protein Information
arginine/serine-rich protein 1
UniProt Protein Name
Arginine/serine-rich protein 1
Protein Family
UniProt Gene Name
RSRP1
UniProt Synonym Gene Names
C1orf63
UniProt Entry Name
RSRP1_HUMAN
Research Articles on RSRP1
Similar Products
Product Notes
The RSRP1 rsrp1 (Catalog #AAA3208991) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RSRP1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RSRP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RSRP1 rsrp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PTQQRSIAFS SNNSVAKPIQ KSAKAATEEA SSRSPKIDQK KSPYGLWIPI. It is sometimes possible for the material contained within the vial of "RSRP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
