Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RSRC1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlRSRC1 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit RSRC1 Polyclonal Antibody | anti-RSRC1 antibody

RSRC1 Antibody - N-terminal region

Gene Names
RSRC1; BM-011; SFRS21; SRrp53
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RSRC1; Polyclonal Antibody; RSRC1 Antibody - N-terminal region; anti-RSRC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRTYSRKKGGRKSRSKSRSWSRDLQPRSHSYDRRRRHRSSSSSSYGSRRK
Sequence Length
334
Applicable Applications for anti-RSRC1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RSRC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RSRC1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlRSRC1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: RSRC1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlRSRC1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-RSRC1 antibody
This is a rabbit polyclonal antibody against RSRC1. It was validated on Western Blot

Target Description: Serine- and arginine-rich (SR) proteins and SR-related proteins, like RSRC1, function in spliceosome assembly and participate in multiple steps of mRNA splicing.
Product Categories/Family for anti-RSRC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
serine/Arginine-related protein 53 isoform 1
NCBI Official Synonym Full Names
arginine and serine rich coiled-coil 1
NCBI Official Symbol
RSRC1
NCBI Official Synonym Symbols
BM-011; SFRS21; SRrp53
NCBI Protein Information
serine/Arginine-related protein 53
UniProt Protein Name
Serine/Arginine-related protein 53
UniProt Gene Name
RSRC1
UniProt Synonym Gene Names
SRRP53; SRrp53
UniProt Entry Name
RSRC1_HUMAN

NCBI Description

This gene encodes a member of the serine and arginine rich-related protein family. The encoded protein is involved in both constitutive and alternative mRNA splicing. This gene may be associated with schizophrenia. A pseudogene of this gene is located on chromosome 9. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2012]

Uniprot Description

RSRC1: Plays a role in pre-mRNA splicing. Involved in both constitutive and alternative pre-mRNA splicing. May have a role in the recognition of the 3' splice site during the second step of splicing. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA splicing

Chromosomal Location of Human Ortholog: 3q25.32

Cellular Component: cytoplasm; nuclear speck; nucleus

Molecular Function: protein binding

Biological Process: nuclear mRNA splicing, via spliceosome; alternative nuclear mRNA splicing, via spliceosome; response to antibiotic; RNA splicing; nucleocytoplasmic transport; protein amino acid phosphorylation

Research Articles on RSRC1

Similar Products

Product Notes

The RSRC1 rsrc1 (Catalog #AAA3217617) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RSRC1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RSRC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RSRC1 rsrc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRTYSRKKGG RKSRSKSRSW SRDLQPRSHS YDRRRRHRSS SSSSYGSRRK. It is sometimes possible for the material contained within the vial of "RSRC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.