Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using RRP36 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Rabbit anti-Human RRP36 Polyclonal Antibody | anti-RRP36 antibody
RRP36 Polyclonal Antibody
Gene Names
RRP36; C6orf153; dJ20C7.4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
RRP36; Polyclonal Antibody; RRP36 Polyclonal Antibody; C6orf153; dJ20C7.4; anti-RRP36 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQVGTKTYKQLVAGNSPKKQASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQQLLQRMEQQEMAQQERKQQQELHLALKQERRAQAQQGHRPYFLKKSEQRQLALAEKFKELKRSKKLENFLSRKRRRNAGKDRRHLP
Sequence Length
254
Applicable Applications for anti-RRP36 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human RRP36
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus, nucleolus
Positive Samples
MCF7, 293T, BxPC-3, HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using RRP36 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using RRP36 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Product Categories/Family for anti-RRP36 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 29kDa
Observed: 36kDa
Observed: 36kDa
NCBI Official Full Name
ribosomal RNA processing protein 36 homolog isoform 2
NCBI Official Synonym Full Names
ribosomal RNA processing 36
NCBI Official Symbol
RRP36
NCBI Official Synonym Symbols
C6orf153; dJ20C7.4
NCBI Protein Information
ribosomal RNA processing protein 36 homolog
UniProt Protein Name
Ribosomal RNA processing protein 36 homolog
Protein Family
UniProt Gene Name
RRP36
UniProt Synonym Gene Names
C6orf153
NCBI Description
RRP36 functions at an early stage in the processing of 35S preribosomal RNA into the mature 18S species (Gerus et al., 2010 [PubMed 20038530]).[supplied by OMIM, Jul 2010]
Uniprot Description
Involved in the early processing steps of the pre-rRNA in the maturation pathway leading to the 18S rRNA.
Research Articles on RRP36
Similar Products
Product Notes
The RRP36 rrp36 (Catalog #AAA9134333) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RRP36 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RRP36 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the RRP36 rrp36 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPGANYRAGA GAGAGARRPR GARDREEDGG GLEPAAVARD LLRGTSNMSF EELLELQSQV GTKTYKQLVA GNSPKKQASR PPIQNACVAD KHRPLEMSAK IRVPFLRQVV PISKKVARDP RFDDLSGEYN PEVFDKTYQF LNDIRAKEKE LVKKQLKKHL SGEEHEKLQQ LLQRMEQQEM AQQERKQQQE LHLALKQERR AQAQQGHRPY FLKKSEQRQL ALAEKFKELK RSKKLENFLS RKRRRNAGKD RRHLP. It is sometimes possible for the material contained within the vial of "RRP36, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
