Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RRM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Rabbit RRM2 Polyclonal Antibody | anti-RRM2 antibody

RRM2 antibody - N-terminal region

Gene Names
RRM2; R2; RR2; RR2M
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RRM2; Polyclonal Antibody; RRM2 antibody - N-terminal region; anti-RRM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP
Sequence Length
389
Applicable Applications for anti-RRM2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RRM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RRM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-RRM2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)
Related Product Information for anti-RRM2 antibody
This is a rabbit polyclonal antibody against RRM2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RRM2 provides the precursors necessary for DNA synthesis. RRM2 catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. RRM2 inhibits Wnt signaling.Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
ribonucleoside-diphosphate reductase subunit M2 isoform 2
NCBI Official Synonym Full Names
ribonucleotide reductase regulatory subunit M2
NCBI Official Symbol
RRM2
NCBI Official Synonym Symbols
R2; RR2; RR2M
NCBI Protein Information
ribonucleoside-diphosphate reductase subunit M2
UniProt Protein Name
Ribonucleoside-diphosphate reductase subunit M2
UniProt Gene Name
RRM2
UniProt Synonym Gene Names
RR2
UniProt Entry Name
RIR2_HUMAN

NCBI Description

This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq, Sep 2009]

Uniprot Description

RRM2: Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling. Belongs to the ribonucleoside diphosphate reductase small chain family.

Protein type: Nucleotide Metabolism - purine; Oxidoreductase; EC 1.17.4.1; Nucleotide Metabolism - pyrimidine; Other Amino Acids Metabolism - glutathione

Chromosomal Location of Human Ortholog: 2p25-p24

Cellular Component: nucleoplasm; cytoplasm; nucleus; cytosol

Molecular Function: protein binding; metal ion binding; ribonucleoside-diphosphate reductase activity

Biological Process: G1/S-specific transcription in mitotic cell cycle; deoxyribonucleoside diphosphate metabolic process; nucleobase, nucleoside and nucleotide metabolic process; nucleobase, nucleoside and nucleotide interconversion; deoxyribonucleotide biosynthetic process; protein heterotetramerization; mitotic cell cycle; DNA replication; G1/S transition of mitotic cell cycle

Research Articles on RRM2

Similar Products

Product Notes

The RRM2 rrm2 (Catalog #AAA3208006) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RRM2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RRM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RRM2 rrm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PALSGTRVLA SKTARRIFQE PTEPKTKAAA PGVEDEPLLR ENPRRFVIFP. It is sometimes possible for the material contained within the vial of "RRM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.