Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RRAGASample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human RRAGA Polyclonal Antibody | anti-RRAGA antibody

RRAGA Antibody - middle region

Gene Names
RRAGA; FIP1; RAGA; FIP-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RRAGA; Polyclonal Antibody; RRAGA Antibody - middle region; anti-RRAGA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVES
Sequence Length
167
Applicable Applications for anti-RRAGA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RRAGA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RRAGASample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RRAGASample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-RRAGA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa
NCBI Official Full Name
ras-related GTP-binding protein A
NCBI Official Synonym Full Names
Ras related GTP binding A
NCBI Official Symbol
RRAGA
NCBI Official Synonym Symbols
FIP1; RAGA; FIP-1
NCBI Protein Information
ras-related GTP-binding protein A
UniProt Protein Name
Ras-related GTP-binding protein A
UniProt Gene Name
RRAGA
UniProt Entry Name
RRAGA_HUMAN

Uniprot Description

RRAGA: Has guanine nucleotide-binding activity but undetectable intrinsic GTPase activity. Required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids. Involved in the RCC1/Ran-GTPase pathway. May play a direct role in a TNF- alpha signaling pathway leading to induction of cell death. May alternatively act as a cellular target for adenovirus E3-14.7K, an inhibitor of TNF-alpha functions, thereby affecting cell death. Can occur as a homodimer, or form a heterodimer with RRAGC or RRAGD in a sequence-independent manner. Binds GTP. The GTP-bound form of RRAGA interacts with NOL8. Interacts with adenovirus E3 14.7 kDa protein. Ubiquitously expressed with highest levels of expression in skeletal muscle, heart, and brain. Belongs to the GTR/RAG GTP-binding protein family.

Protein type: G protein regulator, misc.

Chromosomal Location of Human Ortholog: 9p22.1

Cellular Component: Golgi apparatus; intracellular membrane-bound organelle; lysosomal membrane; lysosome; cytoplasm; nucleus

Molecular Function: GTPase activity; protein binding; protein homodimerization activity; GDP binding; GTP binding; protein heterodimerization activity; phosphoprotein binding

Biological Process: cell death; metabolic process; apoptosis; virus-host interaction; positive regulation of cytolysis; regulation of autophagy; cellular response to starvation; positive regulation of TOR signaling pathway

Research Articles on RRAGA

Similar Products

Product Notes

The RRAGA rraga (Catalog #AAA3220544) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RRAGA Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RRAGA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RRAGA rraga for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HSHVRFLGNL VLNLWDCGGQ DTFMENYFTS QRDNIFRNVE VLIYVFDVES. It is sometimes possible for the material contained within the vial of "RRAGA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.