The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide
recombinant proteins, antibodies and ELISA kits to most target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '25616'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
1.75 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '25616' and pd.language_id = 1
Query
Database
1.33 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25616'
Query
Database
7.33 ms
UPDATE `products_description` SET `products_viewed` = products_viewed + 1
WHERE `products_id` = 25616
Database (5 total Queries, 5 of them unique across 2 Connections)
Time
Query String
2.09 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '25616'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '25616' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25616'
⇄specificity => string (22) "Recognizes human ARNT."
$value['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value['purity']
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value['app_notes']
⇄⧉testing_protocols => string (1145) "WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell lin...
$value['testing_protocols']
WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell line, cotransfected with ARNT Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARNT monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA25616_WB7.jpg!!WB (Western Blot)||Western Blot analysis of ARNT expression in transfected 293T cell line by ARNT monoclonal antibody. Lane 1: ARNT transfected lysate (86.6kD). Lane 2: Non-transfected lysate.||AAA25616_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged ARNT is ~0.03ng/ml as a capture antibod||AAA25616_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to ARNT on HeLa cell. [antibody concentration 10ug/ml].||AAA25616_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ARNT on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml].||AAA25616_IHC3.jpg!!WB (Western Blot)||ARNT monoclonal antibody Western Blot analysis of ARNT expression in Hela NE.||AAA25616_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.73kD).||AAA25616_WB.jpg
⇄⧉etc_term1 => string (276) "Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH...
$value['etc_term1']
Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH60838) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT!!Conjugate||PE
⇄specificity => string (22) "Recognizes human ARNT."
$value->a['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value->a['purity']
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value->a['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value->a['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value->a['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value->a['app_notes']
⇄⧉testing_protocols => string (1145) "WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell lin...
$value->a['testing_protocols']
WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell line, cotransfected with ARNT Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARNT monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA25616_WB7.jpg!!WB (Western Blot)||Western Blot analysis of ARNT expression in transfected 293T cell line by ARNT monoclonal antibody. Lane 1: ARNT transfected lysate (86.6kD). Lane 2: Non-transfected lysate.||AAA25616_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged ARNT is ~0.03ng/ml as a capture antibod||AAA25616_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to ARNT on HeLa cell. [antibody concentration 10ug/ml].||AAA25616_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ARNT on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml].||AAA25616_IHC3.jpg!!WB (Western Blot)||ARNT monoclonal antibody Western Blot analysis of ARNT expression in Hela NE.||AAA25616_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.73kD).||AAA25616_WB.jpg
⇄⧉etc_term1 => string (276) "Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH...
$value->a['etc_term1']
Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH60838) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT!!Conjugate||PE
⇄specificity => string (22) "Recognizes human ARNT."
$value->d['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value->d['purity']
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value->d['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value->d['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value->d['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value->d['app_notes']
⇄⧉testing_protocols => string (1145) "WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell lin...
$value->d['testing_protocols']
WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell line, cotransfected with ARNT Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARNT monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA25616_WB7.jpg!!WB (Western Blot)||Western Blot analysis of ARNT expression in transfected 293T cell line by ARNT monoclonal antibody. Lane 1: ARNT transfected lysate (86.6kD). Lane 2: Non-transfected lysate.||AAA25616_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged ARNT is ~0.03ng/ml as a capture antibod||AAA25616_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to ARNT on HeLa cell. [antibody concentration 10ug/ml].||AAA25616_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ARNT on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml].||AAA25616_IHC3.jpg!!WB (Western Blot)||ARNT monoclonal antibody Western Blot analysis of ARNT expression in Hela NE.||AAA25616_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.73kD).||AAA25616_WB.jpg
⇄⧉etc_term1 => string (276) "Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH...
$value->d['etc_term1']
Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH60838) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT!!Conjugate||PE
⇄specificity => string (22) "Recognizes human ARNT."
$value[0]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[0]['_source']['purity']
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[0]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[0]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[0]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[0]['_source']['app_tested']
⇄app_notes => string (65) "IHC-P: 3ug/ml<br>Applications are based on unconjugated antibody."
$value[0]['_source']['app_notes']
⇄⧉testing_protocols => string (1145) "WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell lin...
$value[0]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell line, cotransfected with ARNT Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARNT monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA25323_WB7.jpg!!WB (Western Blot)||Western Blot analysis of ARNT expression in transfected 293T cell line by ARNT monoclonal antibody. Lane 1: ARNT transfected lysate (86.6kD). Lane 2: Non-transfected lysate.||AAA25323_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged ARNT is ~0.03ng/ml as a capture antibod||AAA25323_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to ARNT on HeLa cell. [antibody concentration 10ug/ml].||AAA25323_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ARNT on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml].||AAA25323_IHC3.jpg!!WB (Western Blot)||ARNT monoclonal antibody Western Blot analysis of ARNT expression in Hela NE.||AAA25323_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.73kD).||AAA25323_WB.jpg
⇄⧉etc_term1 => string (277) "Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH...
$value[0]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH60838) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT!!Conjugate||HRP
⇄etc_term2 => string (3) "N/A"
$value[0]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[0]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[0]['_source']['products_weight']
⇄products_status => boolean true
$value[0]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[0]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "600"
$value[0]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[0]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[0]['_source']['language_id']
⇄products_name => string (4) "ARNT"
$value[0]['_source']['products_name']
⇄⧉products_name_oem => string (226) "ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E ...
$value[0]['_source']['products_name_oem']
ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) (HRP)
⇄⧉search_terms => string (1333) "aaa25323 mouse human monoclonal igg2a,k 3d10 purified by protein a affinity ...
$value[0]['_source']['search_terms']
aaa25323 mouse human monoclonal igg2a,k 3d10 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes arnt elisa eia immunohistochemistry ihc paraffin western blot wb p 3ug ml applications are based on unconjugated antibody detection against immunogen 37.73kd aaa25323_wb analysis of expression hela ne aaa25323_wb2 immunoperoxidase to formalin fixed embedded lung concentration aaa25323_ihc3 immunofluorescence if cell 10ug aaa25323_if4 testing data limit for recombinant gst tagged is ~0.03ng capture antibod aaa25323_td5 transfected 293t line lane 1 lysate 86.6kd 2 non aaa25323_wb6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa25323_wb7 aryl hydrocarbon receptor nuclear translocator class e basic helix loop bhlhe2 dioxin hypoxia inducible factor beta hif hif1 homo sapiens mrna hif1b tango hif1beta 1beta subunit 86,366 da 38173805 bc060838 aah60838 p27540 q59ed4 q5qp39 q8ndc7 b2r9h1 c4ama1 f8wap6 antibodies transcription factors partial corresponding aa1 110 from tag mw the alone 26kd sequence maattanpemtsdvpslgpaiasgnsgpgiqgggaivqraikrrpgldfdddgegnskflrcdddqmsndkerfarsddeqssadkerlarenhseierrrrnkmtayit conjugate ph7.2 lane1 86.6kd2 expressed293 aa1110
⇄specificity => string (22) "Recognizes human ARNT."
$value[1]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[1]['_source']['purity']
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value[1]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value[1]['_source']['concentration']
⇄⧉storage_stability => string (488) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[1]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[1]['_source']['app_notes']
⇄⧉testing_protocols => string (1145) "WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell lin...
$value[1]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell line, cotransfected with ARNT Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARNT monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA25027_WB7.jpg!!WB (Western Blot)||Western Blot analysis of ARNT expression in transfected 293T cell line by ARNT monoclonal antibody. Lane 1: ARNT transfected lysate (86.6kD). Lane 2: Non-transfected lysate.||AAA25027_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged ARNT is ~0.03ng/ml as a capture antibod||AAA25027_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to ARNT on HeLa cell. [antibody concentration 10ug/ml].||AAA25027_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ARNT on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml].||AAA25027_IHC3.jpg!!WB (Western Blot)||ARNT monoclonal antibody Western Blot analysis of ARNT expression in Hela NE.||AAA25027_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.73kD).||AAA25027_WB.jpg
⇄⧉etc_term1 => string (278) "Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH...
$value[1]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH60838) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT!!Conjugate||FITC
⇄etc_term2 => string (3) "N/A"
$value[1]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[1]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[1]['_source']['products_weight']
⇄products_status => boolean true
$value[1]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[1]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "600"
$value[1]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[1]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[1]['_source']['language_id']
⇄products_name => string (4) "ARNT"
$value[1]['_source']['products_name']
⇄⧉products_name_oem => string (227) "ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E ...
$value[1]['_source']['products_name_oem']
ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) (FITC)
⇄⧉search_terms => string (1336) "aaa25027 mouse human monoclonal igg2a,k 3d10 purified by protein a affinity ...
$value[1]['_source']['search_terms']
aaa25027 mouse human monoclonal igg2a,k 3d10 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes arnt elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 37.73kd aaa25027_wb analysis of expression hela ne aaa25027_wb2 immunoperoxidase to formalin fixed paraffin embedded lung concentration 3ug aaa25027_ihc3 cell aaa25027_if4 testing data limit for recombinant gst tagged is ~0.03ng capture antibod aaa25027_td5 transfected 293t line lane 1 lysate 86.6kd 2 non aaa25027_wb6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa25027_wb7 aryl hydrocarbon receptor nuclear translocator class e basic helix loop bhlhe2 dioxin hypoxia inducible factor beta hif hif1 homo sapiens mrna hif1b tango hif1beta 1beta subunit 86,366 da 38173805 bc060838 aah60838 p27540 q59ed4 q5qp39 q8ndc7 b2r9h1 c4ama1 f8wap6 antibodies transcription factors partial corresponding aa1 110 from tag mw the alone 26kd sequence maattanpemtsdvpslgpaiasgnsgpgiqgggaivqraikrrpgldfdddgegnskflrcdddqmsndkerfarsddeqssadkerlarenhseierrrrnkmtayit conjugate ph7.2 lane1 86.6kd2 expressed293 aa1110
⇄specificity => string (22) "Recognizes human ARNT."
$value[2]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[2]['_source']['purity']
⇄⧉form => string (95) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with All...
$value[2]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄⧉storage_stability => string (364) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[2]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[2]['_source']['app_notes']
⇄⧉testing_protocols => string (1145) "WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell lin...
$value[2]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell line, cotransfected with ARNT Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARNT monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA24435_WB7.jpg!!WB (Western Blot)||Western Blot analysis of ARNT expression in transfected 293T cell line by ARNT monoclonal antibody. Lane 1: ARNT transfected lysate (86.6kD). Lane 2: Non-transfected lysate.||AAA24435_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged ARNT is ~0.03ng/ml as a capture antibod||AAA24435_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to ARNT on HeLa cell. [antibody concentration 10ug/ml].||AAA24435_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ARNT on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml].||AAA24435_IHC3.jpg!!WB (Western Blot)||ARNT monoclonal antibody Western Blot analysis of ARNT expression in Hela NE.||AAA24435_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.73kD).||AAA24435_WB.jpg
⇄⧉etc_term1 => string (277) "Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH...
$value[2]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH60838) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT!!Conjugate||APC
⇄etc_term2 => string (3) "N/A"
$value[2]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[2]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[2]['_source']['products_weight']
⇄products_status => boolean true
$value[2]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[2]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "600"
$value[2]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[2]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[2]['_source']['language_id']
⇄products_name => string (4) "ARNT"
$value[2]['_source']['products_name']
⇄⧉products_name_oem => string (224) "ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E ...
$value[2]['_source']['products_name_oem']
ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) APC
⇄⧉search_terms => string (1324) "aaa24435 mouse human monoclonal igg2a,k 3d10 purified by protein a affinity ...
$value[2]['_source']['search_terms']
aaa24435 mouse human monoclonal igg2a,k 3d10 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes arnt elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 37.73kd aaa24435_wb analysis of expression hela ne aaa24435_wb2 immunoperoxidase to formalin fixed paraffin embedded lung concentration 3ug aaa24435_ihc3 cell aaa24435_if4 testing data limit for recombinant gst tagged is ~0.03ng capture antibod aaa24435_td5 transfected 293t line lane 1 lysate 86.6kd 2 non aaa24435_wb6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa24435_wb7 aryl hydrocarbon receptor nuclear translocator class e basic helix loop bhlhe2 dioxin hypoxia inducible factor beta hif hif1 homo sapiens mrna hif1b tango hif1beta 1beta subunit 86,366 da 38173805 bc060838 aah60838 p27540 q59ed4 q5qp39 q8ndc7 b2r9h1 c4ama1 f8wap6 antibodies transcription factors partial corresponding aa1 110 from tag mw the alone 26kd sequence maattanpemtsdvpslgpaiasgnsgpgiqgggaivqraikrrpgldfdddgegnskflrcdddqmsndkerfarsddeqssadkerlarenhseierrrrnkmtayit conjugate ph7.2 lane1 86.6kd2 expressed293 aa1110
⇄specificity => string (22) "Recognizes human ARNT."
$value[3]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[3]['_source']['purity']
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[3]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[3]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[3]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[3]['_source']['app_notes']
⇄⧉testing_protocols => string (1145) "WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell lin...
$value[3]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell line, cotransfected with ARNT Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARNT monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA25616_WB7.jpg!!WB (Western Blot)||Western Blot analysis of ARNT expression in transfected 293T cell line by ARNT monoclonal antibody. Lane 1: ARNT transfected lysate (86.6kD). Lane 2: Non-transfected lysate.||AAA25616_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged ARNT is ~0.03ng/ml as a capture antibod||AAA25616_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to ARNT on HeLa cell. [antibody concentration 10ug/ml].||AAA25616_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ARNT on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml].||AAA25616_IHC3.jpg!!WB (Western Blot)||ARNT monoclonal antibody Western Blot analysis of ARNT expression in Hela NE.||AAA25616_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.73kD).||AAA25616_WB.jpg
⇄⧉etc_term1 => string (276) "Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH...
$value[3]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH60838) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT!!Conjugate||PE
⇄etc_term2 => string (3) "N/A"
$value[3]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[3]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[3]['_source']['products_weight']
⇄products_status => boolean true
$value[3]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[3]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "600"
$value[3]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[3]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[3]['_source']['language_id']
⇄products_name => string (4) "ARNT"
$value[3]['_source']['products_name']
⇄⧉products_name_oem => string (225) "ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E ...
$value[3]['_source']['products_name_oem']
ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) (PE)
⇄⧉search_terms => string (1323) "aaa25616 mouse human monoclonal igg2a,k 3d10 purified by protein a affinity ...
$value[3]['_source']['search_terms']
aaa25616 mouse human monoclonal igg2a,k 3d10 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes arnt elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 37.73kd aaa25616_wb analysis of expression hela ne aaa25616_wb2 immunoperoxidase to formalin fixed paraffin embedded lung concentration 3ug aaa25616_ihc3 cell aaa25616_if4 testing data limit for recombinant gst tagged is ~0.03ng capture antibod aaa25616_td5 transfected 293t line lane 1 lysate 86.6kd 2 non aaa25616_wb6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa25616_wb7 aryl hydrocarbon receptor nuclear translocator class e basic helix loop bhlhe2 dioxin hypoxia inducible factor beta hif hif1 homo sapiens mrna hif1b tango hif1beta 1beta subunit 86,366 da 38173805 bc060838 aah60838 p27540 q59ed4 q5qp39 q8ndc7 b2r9h1 c4ama1 f8wap6 antibodies transcription factors partial corresponding aa1 110 from tag mw the alone 26kd sequence maattanpemtsdvpslgpaiasgnsgpgiqgggaivqraikrrpgldfdddgegnskflrcdddqmsndkerfarsddeqssadkerlarenhseierrrrnkmtayit conjugate ph7.2 lane1 86.6kd2 expressed293 aa1110
⇄specificity => string (22) "Recognizes human ARNT."
$value[4]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[4]['_source']['purity']
⇄⧉form => string (99) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alk...
$value[4]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
⇄concentration => string (3) "N/A"
$value[4]['_source']['concentration']
⇄⧉storage_stability => string (304) "Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 mont...
$value[4]['_source']['storage_stability']
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (58) "ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)"
$value[4]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[4]['_source']['app_notes']
⇄testing_protocols => string (3) "N/A"
$value[4]['_source']['testing_protocols']
⇄⧉etc_term1 => string (276) "Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH...
$value[4]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH60838) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT!!Conjugate||AP
⇄etc_term2 => string (3) "N/A"
$value[4]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[4]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[4]['_source']['products_weight']
⇄products_status => boolean true
$value[4]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[4]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "600"
$value[4]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[4]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[4]['_source']['language_id']
⇄products_name => string (4) "ARNT"
$value[4]['_source']['products_name']
⇄⧉products_name_oem => string (225) "ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E ...
$value[4]['_source']['products_name_oem']
ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) (AP)
⇄⧉search_terms => string (1335) "aaa24140 mouse human monoclonal igg2a,k 3d10 purified by protein a affinity ...
$value[4]['_source']['search_terms']
aaa24140 mouse human monoclonal igg2a,k 3d10 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with alkaline phosphatase ap recognizes arnt elisa eia immunohistochemistry ihc western blot wb applications are based on unconjugated antibody detection against immunogen 37.73kd mbs645542_wb analysis of expression hela ne mbs645542_wb2 immunoperoxidase to formalin fixed paraffin embedded lung concentration 3ug ml mbs645542_ihc3 immunofluorescence if cell 10ug mbs645542_if4 testing data limit for recombinant gst tagged is ~0.03ng capture antibod mbs645542_td5 transfected 293t line lane 1 lysate 86.6kd 2 non mbs645542_wb6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading mbs645542_wb7 aryl hydrocarbon receptor nuclear translocator class e basic helix loop bhlhe2 dioxin hypoxia inducible factor beta hif hif1 homo sapiens mrna hif1b tango hif1beta 1beta subunit 86,366 da 38173805 bc060838 aah60838 p27540 q59ed4 q5qp39 q8ndc7 b2r9h1 c4ama1 f8wap6 antibodies transcription factors partial corresponding aa1 110 from tag mw the alone 26kd sequence maattanpemtsdvpslgpaiasgnsgpgiqgggaivqraikrrpgldfdddgegnskflrcdddqmsndkerfarsddeqssadkerlarenhseierrrrnkmtayit conjugate ph7.2 lane1 86.6kd2 expressed293 aa1110
⇄specificity => string (22) "Recognizes human ARNT."
$value[5]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[5]['_source']['purity']
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[5]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[5]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[5]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
⇄app_notes => string (63) "IF: 10ug/ml<br>Applications are based on unconjugated antibody."
$value[5]['_source']['app_notes']
⇄⧉testing_protocols => string (1145) "WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell lin...
$value[5]['_source']['testing_protocols']
WB (Western Blot)||Western blot analysis of ARNT over-expressed 293 cell line, cotransfected with ARNT Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARNT monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.||AAA24730_WB7.jpg!!WB (Western Blot)||Western Blot analysis of ARNT expression in transfected 293T cell line by ARNT monoclonal antibody. Lane 1: ARNT transfected lysate (86.6kD). Lane 2: Non-transfected lysate.||AAA24730_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged ARNT is ~0.03ng/ml as a capture antibod||AAA24730_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to ARNT on HeLa cell. [antibody concentration 10ug/ml].||AAA24730_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ARNT on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml].||AAA24730_IHC3.jpg!!WB (Western Blot)||ARNT monoclonal antibody Western Blot analysis of ARNT expression in Hela NE.||AAA24730_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.73kD).||AAA24730_WB.jpg
⇄⧉etc_term1 => string (280) "Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH...
$value[5]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa1-110 from human ARNT (AAH60838) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT!!Conjugate||Biotin
⇄etc_term2 => string (3) "N/A"
$value[5]['_source']['etc_term2']
⇄products_price => string (6) "0.0000"
$value[5]['_source']['products_price']
⇄products_weight => string (4) "5.00"
$value[5]['_source']['products_weight']
⇄products_status => boolean true
$value[5]['_source']['products_status']
⇄products_tax_class_id => string (1) "1"
$value[5]['_source']['products_tax_class_id']
⇄manufacturers_id => string (3) "600"
$value[5]['_source']['manufacturers_id']
⇄products_ordered => string (1) "0"
$value[5]['_source']['products_ordered']
⇄language_id => string (1) "1"
$value[5]['_source']['language_id']
⇄products_name => string (4) "ARNT"
$value[5]['_source']['products_name']
⇄⧉products_name_oem => string (229) "ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E ...
$value[5]['_source']['products_name_oem']
ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) (Biotin)
⇄⧉search_terms => string (1311) "aaa24730 mouse human monoclonal igg2a,k 3d10 purified by protein a affinity ...
$value[5]['_source']['search_terms']
aaa24730 mouse human monoclonal igg2a,k 3d10 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes arnt elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 37.73kd aaa24730_wb analysis of expression hela ne aaa24730_wb2 immunoperoxidase to formalin fixed paraffin embedded lung concentration 3ug aaa24730_ihc3 cell aaa24730_if4 testing data limit for recombinant gst tagged is ~0.03ng capture antibod aaa24730_td5 transfected 293t line lane 1 lysate 86.6kd 2 non aaa24730_wb6 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa24730_wb7 aryl hydrocarbon receptor nuclear translocator class e basic helix loop bhlhe2 dioxin hypoxia inducible factor beta hif hif1 homo sapiens mrna hif1b tango hif1beta 1beta subunit 86,366 da 38173805 bc060838 aah60838 p27540 q59ed4 q5qp39 q8ndc7 b2r9h1 c4ama1 f8wap6 antibodies transcription factors partial corresponding aa1 110 from tag mw the alone 26kd sequence maattanpemtsdvpslgpaiasgnsgpgiqgggaivqraikrrpgldfdddgegnskflrcdddqmsndkerfarsddeqssadkerlarenhseierrrrnkmtayit conjugate ph7.2 lane1 86.6kd2 expressed293 aa1110
⇄⧉specificity => string (385) "This assay has high sensitivity and excellent specificity for detection of H...
$value[6]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of HMW-ADP. No significant cross-reactivity or interference between HMW-ADP and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between HMW-ADP and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[6]['_source']['purity']
⇄form => string (3) "N/A"
$value[6]['_source']['form']
⇄concentration => string (3) "N/A"
$value[6]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1430) "Principle of the Assay: HMW-ADP ELISA kit applies the competitive enzyme imm...
$value[6]['_source']['products_description']
Principle of the Assay: HMW-ADP ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-HMW-ADP antibody and an HMW-ADP-HRP conjugate. The assay sample and buffer are incubated together with HMW-ADP-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the HMW-ADP concentration since HMW-ADP from samples and HMW-ADP-HRP conjugate compete for the anti-HMW-ADP antibody binding site. Since the number of sites is limited, as more sites are occupied by HMW-ADP from the sample, fewer sites are left to bind HMW-ADP-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The HMW-ADP concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This HMW-ADP ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Porcine HMW-ADP. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄⧉search_terms => string (566) "aaa16768 porcine this assay has high sensitivity and excellent specificity f...
$value[6]['_source']['search_terms']
aaa16768 porcine this assay has high sensitivity and excellent specificity for detection of hmw adp no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16768_sc elisa kit molecular weight adiponectin adnp signal transduction samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive 0.1 ?g ml competitive0.1
⇄⧉specificity => string (385) "This assay has high sensitivity and excellent specificity for detection of H...
$value[7]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of HMW-ADP. No significant cross-reactivity or interference between HMW-ADP and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between HMW-ADP and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[7]['_source']['purity']
⇄form => string (3) "N/A"
$value[7]['_source']['form']
⇄concentration => string (3) "N/A"
$value[7]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1428) "Principle of the Assay: HMW-ADP ELISA kit applies the competitive enzyme imm...
$value[7]['_source']['products_description']
Principle of the Assay: HMW-ADP ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-HMW-ADP antibody and an HMW-ADP-HRP conjugate. The assay sample and buffer are incubated together with HMW-ADP-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the HMW-ADP concentration since HMW-ADP from samples and HMW-ADP-HRP conjugate compete for the anti-HMW-ADP antibody binding site. Since the number of sites is limited, as more sites are occupied by HMW-ADP from the sample, fewer sites are left to bind HMW-ADP-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The HMW-ADP concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This HMW-ADP ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse HMW-ADP. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄⧉search_terms => string (307) "aaa16998 mouse typical testing data standard curve for reference only aaa169...
$value[7]['_source']['search_terms']
aaa16998 mouse typical testing data standard curve for reference only aaa16998_sc elisa kit high molecular weight adiponectin hmw adnp signal transduction samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type quantitative competitive sensitivity 0.1 ng ml sensitivity0.1
⇄⧉specificity => string (203) "This assay has high sensitivity and excellent specificity for detection of h...
$value[8]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human HMW Adiponectin. No significant cross-reactivity or interference between human HMW Adiponectin and analogues was observed.
⇄purity => string (3) "N/A"
$value[8]['_source']['purity']
⇄form => string (3) "N/A"
$value[8]['_source']['form']
⇄concentration => string (3) "N/A"
$value[8]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[8]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[8]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (775) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[8]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for HMW Adiponectin has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any HMW Adiponectin present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for HMW Adiponectin is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of HMW Adiponectin bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[8]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[8]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[8]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[8]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[8]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[8]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[8]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[8]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[8]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[8]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[8]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[8]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[8]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[8]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[8]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[8]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[8]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[8]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[8]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[8]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[8]['_source']['products_viewed']
⇄⧉search_terms => string (531) "aaa15365 human this assay has high sensitivity and excellent specificity for...
$value[8]['_source']['search_terms']
aaa15365 human this assay has high sensitivity and excellent specificity for detection of hmw adiponectin no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15365_td elisa kit molecular weight samples serum plasma cell culture supernates tissue homogenates urine type quantitative sandwich range 3.12 ng ml 200 < 0.78 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in ml200
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||0.1-30mg/L!!Sensitivity||0.06mg/L
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[9]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (928) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[9]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Mouse HMW ADPN antibody. HMW ADPN present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Mouse HMW ADPN Antibody is added and binds to HMW ADPN in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated HMW ADPN antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Mouse HMW ADPN. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Mouse High molecular weight Adiponectin (also known as HMW ADPN) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄products_references => string (3) "N/A"
$value[9]['_source']['products_references']
⇄products_related_diseases => string (3) "N/A"
$value[9]['_source']['products_related_diseases']
⇄products_categories => string (3) "N/A"
$value[9]['_source']['products_categories']
⇄ncbi_full_name => string (3) "N/A"
$value[9]['_source']['ncbi_full_name']
⇄ncbi_full_name_syn => string (3) "N/A"
$value[9]['_source']['ncbi_full_name_syn']
⇄ncbi_symbol => string (3) "N/A"
$value[9]['_source']['ncbi_symbol']
⇄ncbi_symbol_syn => string (3) "N/A"
$value[9]['_source']['ncbi_symbol_syn']
⇄ncbi_protein_info => string (3) "N/A"
$value[9]['_source']['ncbi_protein_info']
⇄ncbi_chrom_loc => string (3) "N/A"
$value[9]['_source']['ncbi_chrom_loc']
⇄ncbi_gene_id => string (3) "N/A"
$value[9]['_source']['ncbi_gene_id']
⇄ncbi_mol_weight => string (3) "N/A"
$value[9]['_source']['ncbi_mol_weight']
⇄ncbi_pathways => string (3) "N/A"
$value[9]['_source']['ncbi_pathways']
⇄sp_protein_name => string (3) "N/A"
$value[9]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[9]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (3) "N/A"
$value[9]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "N/A"
$value[9]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (3) "N/A"
$value[9]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[9]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[9]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[9]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[9]['_source']['products_viewed']
⇄⧉search_terms => string (479) "aaa18966 mouse typical testing data standard curve for reference only aaa189...
$value[9]['_source']['search_terms']
aaa18966 mouse typical testing data standard curve for reference only aaa18966_sc elisa kit high molecular weight adiponectin hmw adpn samples serum plasma cell culture supernates ascites tissue homogenates or other biological fluids assay type quantitative sandwich detection range 0.1 30mg l sensitivity 0.06mg intra precision within an three of known concentration were tested on one plate to assess cv<8 inter between assays in separate cv = sd mean x 100 cv<10 range0.1 x100
⇄⧉specificity => string (169) "This assay has high sensitivity and excellent specificity for detection of H...
$value[10]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of HMG1. No significant cross-reactivity or interference between HMG1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[10]['_source']['purity']
⇄form => string (3) "N/A"
$value[10]['_source']['form']
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (475) "The stability of kit is determined by the loss rate of activity. The loss ra...
$value[10]['_source']['storage_stability']
The stability of kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. <br>To minimize extra influence on the performance, operation procedures and lab conditions, especially room temperature, air humidity, incubator temperature should be strictly controlled. It is also strongly suggested that the whole assay is performed by the same operator from the beginning to the end.
Assay Type||Double-antibody Sandwich!!Samples||Serum, Plasma, Tissue homogenates, Cell lysates, Cell culture supernates and other biological fluids!!Detection Range||3.12-200ng/mL!!Sensitivity||1.23ng/mL
⇄⧉etc_term2 => string (414) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[10]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level HMG1 were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level HMG1 were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄⧉products_description => string (964) "Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantit...
$value[10]['_source']['products_description']
Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of HMG1 in human serum, plasma and other biological fluids.<br><br>Principle of the Assay: The microplate provided in this kit has been pre-coated with an antibody specific to HMG1. Standards or samples are then added to the appropriate microplate wells with a biotin-conjugated antibody specific to HMG1. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain HMG1, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +/- 10nm. The concentration of HMG1 in the samples is then determined by comparing the O.D. of the samples to the standard curve.
ACE Inhibitor Pathway||198320!!Class A/1 (Rhodopsin-like Receptors) Pathway||1110499!!Complement And Coagulation Cascades Pathway||198335!!Complement And Coagulation Cascades Pathway||83270!!Complement And Coagulation Cascades Pathway||484!!Defective ACTH Causes Obesity And Pro-opiomelanocortinin Deficiency (POMCD) Pathway||1111486!!Disease Pathway||1111319!!Formation Of Fibrin Clot (Clotting Cascade) Pathway||1110054!!G Alpha (i) Signalling Events Pathway||1110530!!G Alpha (q) Signalling Events Pathway||1110532
⇄sp_protein_name => string (11) "Kininogen-1"
$value[10]['_source']['sp_protein_name']
⇄sp_protein_name_syn => string (3) "N/A"
$value[10]['_source']['sp_protein_name_syn']
⇄sp_gene_name => string (4) "Kng1"
$value[10]['_source']['sp_gene_name']
⇄sp_gene_name_syn => string (3) "Kng"
$value[10]['_source']['sp_gene_name_syn']
⇄sp_entry_name => string (10) "KNG1_MOUSE"
$value[10]['_source']['sp_entry_name']
⇄sp_mim => string (3) "N/A"
$value[10]['_source']['sp_mim']
⇄sp_interactions => string (3) "N/A"
$value[10]['_source']['sp_interactions']
⇄products_url => string (3) "N/A"
$value[10]['_source']['products_url']
⇄products_viewed => string (1) "0"
$value[10]['_source']['products_viewed']
⇄⧉search_terms => string (763) "aaa20375 human this assay has high sensitivity and excellent specificity for...
$value[10]['_source']['search_terms']
aaa20375 human this assay has high sensitivity and excellent specificity for detection of hmg1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa20375_sc elisa kit molecular weight kininogen hmwk williams fitzgerald flaujeac factor kallikrein i isoform deltad5 1 kng1 kng 53,206 da kng1_mouse 50082914 aat70087.1 o08677 o08676 q32mx7 q6s9i1 q91xk5 enzyme kinase hematology samples serum plasma other biological fluids type quantitative sandwich range 62.5 4,000pg ml 28.3pg intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv<10 inter assays different plates 8 replicates in each cv = sd meanx100 cv<12 deltad51 an3 tested20 plates8
⇄⧉products_description => string (826) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[11]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Human LMWH monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (484) "aaa12937 human no cross reaction with other factors typical testing data sta...
$value[11]['_source']['search_terms']
aaa12937 human no cross reaction with other factors typical testing data standard curve for reference only aaa12937_td elisa kit low molecular weight heparin lmwh lipoprotein lipase lpl 53,082 da lipl_rat 6981168 np_036730.1 q06000 nm_012598.2 samples serum plasma or cell culture supernatant and organizations in the natural recombinant concentration assay type sandwich detection range 100 ng ml 1.56 sensitivity 0.5 intra precision <= 8 inter 12 range100 sensitivity0.5 <=8 inter12
⇄⧉specificity => string (385) "This assay has high sensitivity and excellent specificity for detection of H...
$value[12]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of HMW-ADP. No significant cross-reactivity or interference between HMW-ADP and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between HMW-ADP and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[12]['_source']['purity']
⇄form => string (3) "N/A"
$value[12]['_source']['form']
⇄concentration => string (3) "N/A"
$value[12]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1426) "Principle of the Assay: HMW-ADP ELISA kit applies the competitive enzyme imm...
$value[12]['_source']['products_description']
Principle of the Assay: HMW-ADP ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-HMW-ADP antibody and an HMW-ADP-HRP conjugate. The assay sample and buffer are incubated together with HMW-ADP-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the HMW-ADP concentration since HMW-ADP from samples and HMW-ADP-HRP conjugate compete for the anti-HMW-ADP antibody binding site. Since the number of sites is limited, as more sites are occupied by HMW-ADP from the sample, fewer sites are left to bind HMW-ADP-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The HMW-ADP concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This HMW-ADP ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Rat HMW-ADP. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄⧉search_terms => string (562) "aaa17058 rat this assay has high sensitivity and excellent specificity for d...
$value[12]['_source']['search_terms']
aaa17058 rat this assay has high sensitivity and excellent specificity for detection of hmw adp no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa17058_sc elisa kit molecular weight adiponectin adnp signal transduction samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive 0.1 ug ml competitive0.1
⇄⧉storage_stability => string (196) "At -20 degree C for one year. After reconstitution, at 4 degree C for one mo...
$value[13]['_source']['storage_stability']
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
IHC (Immunohistchemistry)||Anti-Adiponectin antibody, AAA11599, IHC(P)<br>IHC(P): Human Placenta Tissue||AAA11599_IHC6.jpg!!IHC (Immunohistochemistry)||Anti-Adiponectin antibody, AAA11599, IHC(F)<br>IHC(F): Rat Liver Tissue||AAA11599_IHC5.jpg!!IHC (Immunohistochemistry)||Anti-Adiponectin antibody, AAA11599, IHC(P)<br>IHC(P): Mouse Kidney Tissue||AAA11599_IHC4.jpg!!IHC (Immunohistochemistry)||Anti-Adiponectin antibody, AAA11599, IHC(P)<br>IHC(P): Rat Kidney Tissue||AAA11599_IHC3.jpg!!WB (Western Blot)||Anti-Adiponectin antibody, AAA11599, Western blotting<br>Recombinant Protein Detection Source: E.coli derived -recombinant Human ADIPOQ, 44.4 KD(162aa tag+ M1-N244)<br>Lane 1: Recombinant Human ADIPOQ Protein 10ng<br>Lane 2: Recombinant Human ADIPOQ Protein 5ng<br>Lane 3: Recombinant Human ADIPOQ Protein 2.5ng||AAA11599_WB2.jpg!!WB (Western Blot)||Anti-Adiponectin antibody, AAA11599, Western blotting<br>WB: Rat Heart Tissue Lysate||AAA11599_WB.jpg
⇄⧉etc_term1 => string (197) "Immunogen||A synthetic peptide corresponding to a sequence at the C-terminus...
$value[13]['_source']['etc_term1']
Immunogen||A synthetic peptide corresponding to a sequence at the C-terminus of human ADIPOQ (224-244aa LYADNDNDSTFTGFLLYHDTN), different from the related mouse and rat sequences by one amino acid.
Contents||Each vial contains 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.!!Reconstitution||Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
<b>Description: </b>Rabbit IgG polyclonal antibody for Adiponectin(ADIPOQ) detection. Tested with WB, IHC-P, IHC-F, ELISA in Human, Mouse, Rat.<br><b>Background: </b>ADIPOQ(Adipocyte-, C1q-, and Collagen Domain-Containing), also known as APM1, ADPN or ACDC, is a protein which in humans is encoded by the ADIPOQ gene. Using FISH, Das et al.(2001) mapped the mouse Acrp30 gene to chromosome 16 in a region showing homology of synteny with human 3q27. By RNase protection and Western blot analysis, Schaffler et al.(1999) showed that APM1 is expressed by differentiated adipocytes as a 33-kD protein that is also detectable in serum. By sequence comparisons, they found links between APM1 and TNF family ligands as well as to cytokines expressed by T cells. Adiponectin is a protein hormone that modulates a number of metabolic processes, including glucose regulation and fatty acid oxidation. Adiponectin is exclusively secreted from adipose tissue(and also from the placenta in pregnancy) into the bloodstream and is very abundant in plasma relative to many hormones.
⇄⧉search_terms => string (1012) "aaa11599 rabbit human mouse rat polyclonal igg immunogen affinity purified l...
$value[13]['_source']['search_terms']
aaa11599 rabbit human mouse rat polyclonal igg immunogen affinity purified lyophilized western blot wb immunohistochemistry ihc paraffin formalin elisa eia anti adiponectin antibody blotting heart tissue lysate aaa11599_wb recombinant protein detection source e.coli derived adipoq 44.4 kd 162aa tag+ m1 n244 lane 1 10ng 2 5ng 3 2.5ng aaa11599_wb2 p kidney aaa11599_ihc3 aaa11599_ihc4 f liver aaa11599_ihc5 placenta aaa11599_ihc6 c1q and collagen domain containing 30 kda adipocyte complement related acdc acrp acrp30 adipo_human of adipose most abundant gene transcript specific like factor adipqtl1 adpn apm apm1 gbp 28 gbp28 gelatin binding 26,414 da 2493789 q15848.1 q15848 q58ex9 612556 a synthetic peptide corresponding to sequence at the c terminus 224 244aa lyadndndstftgfllyhdtn different from sequences by one amino acid contents each vial contains 0.9mg nacl 0.2mg na2hpo4 0.05mg nan3 reconstitution add 0.2ml distilled water will yield concentration 500ug ml lane1 10ng2 5ng3 containing30 terminus224
⇄⧉specificity => string (167) "This assay has high sensitivity and excellent specificity for detection of A...
$value[14]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of ADP. No significant cross-reactivity or interference between ADP and analogues was observed.
⇄purity => string (3) "N/A"
$value[14]['_source']['purity']
⇄form => string (3) "N/A"
$value[14]['_source']['form']
⇄concentration => string (3) "N/A"
$value[14]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[14]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[14]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄⧉search_terms => string (663) "aaa17476 human this assay has high sensitivity and excellent specificity for...
$value[14]['_source']['search_terms']
aaa17476 human this assay has high sensitivity and excellent specificity for detection of adp no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17476_sc elisa kit adiponectin adipoq acrp30 gbp28 acdc adpn c1q collagen domain containing apm1 apm 1 adipqtl1 26,414 da 30 kda adipocyte complement related protein adipose most abundant gene transcript gelatin binding adipo_human 295317372 np_001171271.1 q15848 nm_001177800.1 q58ex9 125853 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 1.563 100ng ml 0.938ng intra precision cv da30
⇄⧉specificity => string (198) "The Human Adiponectin ELISA Kit allows for the detection and quantification ...
$value[15]['_source']['specificity']
The Human Adiponectin ELISA Kit allows for the detection and quantification of endogenous levels of natural and/or recombinant Human Adiponectin proteins within the range of 62.5 pg/ml - 4000 pg/ml.
⇄purity => string (3) "N/A"
$value[15]['_source']['purity']
⇄form => string (3) "N/A"
$value[15]['_source']['form']
⇄concentration => string (3) "N/A"
$value[15]['_source']['concentration']
⇄⧉storage_stability => string (107) "Shipped and store at 4 degree C for 6 months, store at -20 degree C for one ...
$value[15]['_source']['storage_stability']
Shipped and store at 4 degree C for 6 months, store at -20 degree C for one year. Avoid freeze/thaw cycles.
⇄⧉products_description => string (1596) "Principle of the Assay: The Human Adiponectin ELISA (Enzyme-Linked Immunosor...
$value[15]['_source']['products_description']
Principle of the Assay: The Human Adiponectin ELISA (Enzyme-Linked Immunosorbent Assay) kit is an in vitro enzyme-linked immunosorbent assay for the quantitative measurement of Human Adiponectin in Cell Culture Supernatants, Serum, Plasma, Tissue Homogenates. This assay employs an antibody specific for Human Adiponectin coated on a 96-well plate. Standards and samples are pipetted into the wells and Adiponectin present in a sample is bound to the wells by the immobilized antibody. The wells are washed and biotinylated anti-Human Adiponectin antibody is added. After washing away unbound biotinylated antibody, HRP-conjugated streptavidin is pipetted to the wells. The wells are again washed, a TMB substrate solution is added to the wells and color develops in proportion to the amount of Adiponectin bound. The Stop Solution changes the color from blue to yellow, and the intensity of the color is measured at 450 nm.<br><br>Background/Introduction: Adiponectin (ADPN) is a hormone secreted by adipocytes that regulates energy homeostasis and glucose and lipid metabolism. Adiponectin is a new member of the family of soluble defense collagens, in hematopoiesis and immune responses. It is an important negative regulator in hematopoiesis and immune systems and raise the possibility that it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin is mapped to 3q27 and can protect the organism from systemic inflammation by promoting the clearance of early apoptotic cells by macrophages through a receptor-dependent pathway involving calreticulin.
⇄⧉search_terms => string (641) "aaa17883 human the adiponectin elisa kit allows for detection and quantifica...
$value[15]['_source']['search_terms']
aaa17883 human the adiponectin elisa kit allows for detection and quantification of endogenous levels natural or recombinant proteins within range 62.5 pg ml 4000 sandwich se typical testing data standard curve reference only aaa17883_sc acdc acrp30 apm1 gbp28 30 kda adipocyte complement related protein c1q collagen domain containing adipose most abundant gene transcript 1 apm gelatin binding adipoq adpn adipqtl1 28 specific like factor 26,414 da adipo_human 295317372 np_001171271.1 q15848 nm_001177800.1 q58ex9 612556 samples cell culture supernatants serum plasma tissue homogenates sensitivity < 15 gbp2830 transcript1 adipqtl128 <15
⇄⧉products_description => string (829) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[16]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Canine Acrp30 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (541) "aaa22695 canine typical testing data standard curve for reference only aaa22...
$value[16]['_source']['search_terms']
aaa22695 canine typical testing data standard curve for reference only aaa22695_sc elisa kit adiponectin acrp30 c1q and collagen domain containing adipoq acdc adpn apm1 apm 1 gbp28 adipqtl1 26,414 da 30 kda adipocyte complement related protein adipose most abundant gene transcript gelatin binding adipo_human 295317372 np_001171271.1 q15848 nm_001177800.1 q58ex9 125853 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 100 ng ml 1.56 sensitivity up to 0.5 intra precision da30 range100 to0.5
⇄⧉specificity => string (198) "The Human Adiponectin ELISA Kit allows for the detection and quantification ...
$value[17]['_source']['specificity']
The Human Adiponectin ELISA Kit allows for the detection and quantification of endogenous levels of natural and/or recombinant Human Adiponectin proteins within the range of 62.5 pg/ml - 4000 pg/ml.
⇄purity => string (3) "N/A"
$value[17]['_source']['purity']
⇄form => string (3) "N/A"
$value[17]['_source']['form']
⇄concentration => string (3) "N/A"
$value[17]['_source']['concentration']
⇄⧉storage_stability => string (107) "Shipped and store at 4 degree C for 6 months, store at -20 degree C for one ...
$value[17]['_source']['storage_stability']
Shipped and store at 4 degree C for 6 months, store at -20 degree C for one year. Avoid freeze/thaw cycles.
⇄⧉products_description => string (1602) "Background: Adiponectin (ADPN) is a hormone secreted by adipocytes that regu...
$value[17]['_source']['products_description']
Background: Adiponectin (ADPN) is a hormone secreted by adipocytes that regulates energy homeostasis and glucose and lipid metabolism. Adiponectin is a new member of the family of soluble defense collagens, in hematopoiesis and immune responses. It is an important negative regulator in hematopoiesis and immune systems and raise the possibility that it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin is mapped to 3q27 and can protect the organism from systemic inflammation by promoting the clearance of early apoptotic cells by macrophages through a receptor-dependent pathway involving calreticulin.<br><br>Principle of the Assay: The Cohesion Bioscience Human Adiponectin ELISA (Enzyme-Linked Immunosorbent Assay) kit is an in vitro enzyme-linked immunosorbent assay for the quantitative measurement of Human Adiponectin in Cell Culture Supernatants, Serum, Plasma, Tissue Homogenates. This assay employs an antibody specific for Human Adiponectin coated on a 96-well plate. Standards and samples are pipetted into the wells and Adiponectin present in a sample is bound to the wells by the immobilized antibody. The wells are washed and biotinylated anti-Human Adiponectin antibody is added. After washing away unbound biotinylated antibody, HRP-conjugated streptavidin is pipetted to the wells. The wells are again washed, a TMB substrate solution is added to the wells and color develops in proportion to the amount of Adiponectin bound. The Stop Solution changes the color from blue to yellow, and the intensity of the color is measured at 450 nm.
⇄⧉search_terms => string (599) "aaa27855 human the adiponectin elisa kit allows for detection and quantifica...
$value[17]['_source']['search_terms']
aaa27855 human the adiponectin elisa kit allows for detection and quantification of endogenous levels natural or recombinant proteins within range 62.5 pg ml 4000 sandwich eia typical testing data standard curve reference only aaa27855_sc acdc acrp30 apm1 gbp28 30 kda adipocyte complement related protein c1q collagen domain containing adipose most abundant gene transcript 1 apm gelatin binding adipoq adpn adipqtl1 26,414 da adipo_human 2493789 q15848.1 q15848 q58ex9 125853 samples cell culture supernatants serum plasma tissue homogenates assay type quantitative sensitivity gbp2830 transcript1
⇄⧉specificity => string (183) "This assay has high sensitivity and excellent specificity for detection of a...
$value[18]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of adiponectin. No significant cross-reactivity or interference between adiponectin and analogues was observed.
⇄purity => string (3) "N/A"
$value[18]['_source']['purity']
⇄form => string (3) "N/A"
$value[18]['_source']['form']
⇄concentration => string (3) "N/A"
$value[18]['_source']['concentration']
⇄⧉storage_stability => string (475) "The stability of kit is determined by the loss rate of activity. The loss ra...
$value[18]['_source']['storage_stability']
The stability of kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. <br>To minimize extra influence on the performance, operation procedures and lab conditions, especially room temperature, air humidity, incubator temperature should be strictly controlled. It is also strongly suggested that the whole assay is performed by the same operator from the beginning to the end.
⇄⧉etc_term1 => string (144) "Assay Type||Double-antibody Sandwich!!Samples||Serum, Plasma and other biolo...
$value[18]['_source']['etc_term1']
Assay Type||Double-antibody Sandwich!!Samples||Serum, Plasma and other biological fluids!!Detection Range||3.12-200ng/mL!!Sensitivity||1.14ng/mL
⇄⧉etc_term2 => string (428) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[18]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level adiponectin were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level adiponectin were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
GBP28; ApM1; AdipoQ; Acrp30; ACDC; APM1; C1Q And Collagen Domain Containing; Adipocyte Complement-Related Protein Of 30 KDa; Adipose Most Abundant Gene Transcript 1
⇄products_gene_name => string (3) "ADP"
$value[18]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[18]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1001) "Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantit...
$value[18]['_source']['products_description']
Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of adiponectin in porcine serum, plasma and other biological fluids.<br><br>Principle of the Assay: The microplate provided in this kit has been pre-coated with an antibody specific to adiponectin. Standards or samples are then added to the appropriate microplate wells with a biotin-conjugated antibody specific to adiponectin. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain adiponectin, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +/- 10nm. The concentration of adiponectin in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (809) "aaa20418 porcine this assay has high sensitivity and excellent specificity f...
$value[18]['_source']['search_terms']
aaa20418 porcine this assay has high sensitivity and excellent specificity for detection of adiponectin no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa20418_sc elisa kit adp gbp28 apm1 adipoq acrp30 acdc c1q collagen domain containing adipocyte complement related protein 30 kda adipose most abundant gene transcript 1 adpn apm adipqtl1 26,414 da gelatin binding adipo_human 4757760 np_004788.1 q15848 nm_004797.3 q58ex9 125853 metabolic pathway infection immunity cardiovascular biology samples serum plasma other biological fluids type quantitative sandwich range 3.12 200ng ml < 1.14ng intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv protein30 transcript1 an3 tested20
Assay Type||Quantitative Sandwich!!Samples||Serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids!!Detection Range||0.2-60mg/L!!Sensitivity||0.11mg/L
⇄⧉etc_term2 => string (403) "Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Thr...
$value[19]['_source']['etc_term2']
Intra-assay Precision||Intra-Assay Precision (Precision within an assay) Three samples of known concentration were tested on one plate to assess intra-assay precision. Intra-Assay: CV<8%!!Inter-assay Precision||Inter-Assay Precision (Precision between assays) Three samples of known concentration were tested in separate assays to assess inter-assay precision. CV(%) = SD/mean x 100. Inter-Assay: CV<10%
⇄⧉products_description => string (892) "Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (EL...
$value[19]['_source']['products_description']
Principle of the Assay: This kit is an Enzyme-Linked Immunosorbent Assay (ELISA). The plate has been pre-coated with Human ADIPOQ antibody. ADIPOQ present in the sample is added and binds to antibodies coated on the wells. And then biotinylated Human ADIPOQ Antibody is added and binds to ADIPOQ in the sample. Then Streptavidin-HRP is added and binds to the Biotinylated ADIPOQ antibody. After incubation unbound Streptavidin-HRP is washed away during a washing step. Substrate solution is then added and color develops in proportion to the amount of Human ADIPOQ. The reaction is terminated by addition of acidic stop solution and absorbance is measured at 450 nm.<br><br>Intended Uses: This sandwich kit is for the accurate quantitative detection of Human Adiponectin (also known as ADIPOQ) in serum, plasma, cell culture supernates, Ascites, tissue homogenates or other biological fluids.
⇄⧉search_terms => string (490) "aaa11207 human typical testing data standard curve for reference only aaa112...
$value[19]['_source']['search_terms']
aaa11207 human typical testing data standard curve for reference only aaa11207_sc elisa kit adiponectin adp 26,292 da adipoq 324388018 ady38781.1 samples serum plasma cell culture supernates ascites tissue homogenates or other biological fluids assay type quantitative sandwich detection range 0.2 60mg l sensitivity 0.11mg intra precision within an three of known concentration were tested on one plate to assess cv<8 inter between assays in separate cv = sd mean x 100 cv<10 range0.2 x100
