Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RPLP2 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellRPLP2 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

Rabbit RPLP2 Polyclonal Antibody | anti-RPLP2 antibody

RPLP2 Antibody - N-terminal region

Gene Names
RPLP2; P2; LP2; RPP2; D11S2243E
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RPLP2; Polyclonal Antibody; RPLP2 Antibody - N-terminal region; anti-RPLP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKN
Sequence Length
115
Applicable Applications for anti-RPLP2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Goat: 79%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RPLP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RPLP2 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellRPLP2 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

Western Blot (WB) (WB Suggested Anti-RPLP2 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole CellRPLP2 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)
Related Product Information for anti-RPLP2 antibody
This is a rabbit polyclonal antibody against RPLP2. It was validated on Western Blot

Target Description: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal phosphoprotein that is a component of the 60S subunit. The protein, which is a functional equivalent of the E. coli L7/L12 ribosomal protein, belongs to the L12P family of ribosomal proteins. It plays an important role in the elongation step of protein synthesis. Unlike most ribosomal proteins, which are basic, the encoded protein is acidic. Its C-terminal end is nearly identical to the C-terminal ends of the ribosomal phosphoproteins P0 and P1. The P2 protein can interact with P0 and P1 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Product Categories/Family for anti-RPLP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
60S acidic ribosomal protein P2
NCBI Official Synonym Full Names
ribosomal protein lateral stalk subunit P2
NCBI Official Symbol
RPLP2
NCBI Official Synonym Symbols
P2; LP2; RPP2; D11S2243E
NCBI Protein Information
60S acidic ribosomal protein P2
UniProt Protein Name
60S acidic ribosomal protein P2
UniProt Gene Name
RPLP2
UniProt Synonym Gene Names
D11S2243E; RPP2
UniProt Entry Name
RLA2_HUMAN

NCBI Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal phosphoprotein that is a component of the 60S subunit. The protein, which is a functional equivalent of the E. coli L7/L12 ribosomal protein, belongs to the L12P family of ribosomal proteins. It plays an important role in the elongation step of protein synthesis. Unlike most ribosomal proteins, which are basic, the encoded protein is acidic. Its C-terminal end is nearly identical to the C-terminal ends of the ribosomal phosphoproteins P0 and P1. The P2 protein can interact with P0 and P1 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Uniprot Description

RPLP2: Plays an important role in the elongation step of protein synthesis. Belongs to the ribosomal protein L12P family.

Protein type: Ribosomal; Translation

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: focal adhesion; membrane; cytosol

Molecular Function: structural constituent of ribosome; RNA binding

Biological Process: SRP-dependent cotranslational protein targeting to membrane; translational elongation; cellular protein metabolic process; viral reproduction; translation; translational initiation; mRNA catabolic process, nonsense-mediated decay; gene expression; viral transcription; translational termination; viral infectious cycle

Research Articles on RPLP2

Similar Products

Product Notes

The RPLP2 rplp2 (Catalog #AAA3217002) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPLP2 Antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RPLP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RPLP2 rplp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MRYVASYLLA ALGGNSSPSA KDIKKILDSV GIEADDDRLN KVISELNGKN. It is sometimes possible for the material contained within the vial of "RPLP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.