Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EZR-ROS1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ROS1 Polyclonal Antibody | anti-ROS1 antibody

ROS1 Antibody - C-terminal region

Gene Names
ROS1; ROS; MCF3; c-ros-1
Reactivity
Dog, Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ROS1; Polyclonal Antibody; ROS1 Antibody - C-terminal region; anti-ROS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EGLNYMVLATECGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEK
Sequence Length
858
Applicable Applications for anti-ROS1 antibody
Western Blot (WB)
Homology
Dog: 86%; Horse: 86%; Human: 100%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human ROS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EZR-ROS1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EZR-ROS1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ROS1 antibody
This is a rabbit polyclonal antibody against EZR-ROS1. It was validated on Western Blot

Target Description: This proto-oncogene, highly-expressed in a variety of tumor cell lines, belongs to the sevenless subfamily of tyrosine kinase insulin receptor genes. The protein encoded by this gene is a type I integral membrane protein with tyrosine kinase activity. The protein may function as a growth or differentiation factor receptor.
Product Categories/Family for anti-ROS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
proto-oncogene tyrosine-protein kinase ROS
NCBI Official Synonym Full Names
ROS proto-oncogene 1, receptor tyrosine kinase
NCBI Official Symbol
ROS1
NCBI Official Synonym Symbols
ROS; MCF3; c-ros-1
NCBI Protein Information
proto-oncogene tyrosine-protein kinase ROS
UniProt Protein Name
Proto-oncogene tyrosine-protein kinase ROS
Protein Family
UniProt Gene Name
ROS1
UniProt Synonym Gene Names
MCF3; ROS
UniProt Entry Name
ROS1_HUMAN

NCBI Description

This proto-oncogene, highly-expressed in a variety of tumor cell lines, belongs to the sevenless subfamily of tyrosine kinase insulin receptor genes. The protein encoded by this gene is a type I integral membrane protein with tyrosine kinase activity. The protein may function as a growth or differentiation factor receptor. [provided by RefSeq, Jul 2008]

Uniprot Description

ROS: a proto-oncogenic receptor tyrosine kinase whose expression is tightly restricted during development. Normally expressed in adult murine and human epithelial cells of the epididymis. Transgenic mice lacking the c-ros gene are infertile. Ectopic expression of c-Ros has been reported in meningiomas and astrocytomas. Is up-regulated in human glioma: 30% of malignant glioma tumors are ROS positive. An oncogenic fusion protein between PIST (aka FIG) and ROS, resulting from an intra-chromosomal homozygous deletion of 240 kilobases on 6q21, is found in glioblastoma multiform. PIST (aka FIG) is a peripheral membrane protein associated with the Golgi apparatus. Unlike other fusion RTK oncogenes, the mechanism of activation of PIST-ROS does not appear to be dimerization: the PIST-ROS fusion protein appears to be monomeric in vivo. Rather, activation of the fused ROS kinase appears to depend upon translocation to the golgi apparatus: deletion of 2nd coiled-coil region of PIST, crucial for Golgi localization, appears to eliminate the transformation capacity of PIST-ROS. c-ROS may also be activated epigenetically, suggesting caution when using 5-aza-dC for treating glioma.

Protein type: Kinase, protein; Protein kinase, tyrosine (receptor); Oncoprotein; EC 2.7.10.1; Protein kinase, TK; Membrane protein, integral; TK group; Sev family

Chromosomal Location of Human Ortholog: 6q22

Cellular Component: membrane; integral to membrane; plasma membrane

Molecular Function: protein binding; protein-tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; protein phosphatase binding; ATP binding

Biological Process: cell proliferation; peptidyl-tyrosine phosphorylation; spermatogenesis; cell growth; cell differentiation; columnar/cuboidal epithelial cell development; protein amino acid phosphorylation; transmembrane receptor protein tyrosine kinase signaling pathway; regulation of TOR signaling pathway

Research Articles on ROS1

Similar Products

Product Notes

The ROS1 ros1 (Catalog #AAA3216177) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ROS1 Antibody - C-terminal region reacts with Dog, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ROS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ROS1 ros1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EGLNYMVLAT ECGQGEEKSE GPLGSQESES CGLRKEEKEP HADKDFCQEK. It is sometimes possible for the material contained within the vial of "ROS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.