Western Blot (WB)
(WB Suggested Anti-Romo1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Rabbit Romo1 Polyclonal Antibody | anti-ROMO1 antibody
Romo1 antibody - N-terminal region
Gene Names
Camsap1; C77823; PRO2405; 9530003A05Rik
Reactivity
Tested Reactivity: MousePredicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Romo1; Polyclonal Antibody; Romo1 antibody - N-terminal region; anti-ROMO1 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Mouse
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: PVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRE
Sequence Length
79
Applicable Applications for anti-ROMO1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Protein Size (#AA)
79 amino acids
Blocking Peptide
For anti-Romo1 (MBS3213883) antibody is Catalog # MBS3238821
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Romo1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Romo1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Related Product Information for anti-ROMO1 antibody
This is a rabbit polyclonal antibody against Romo1. It was validated on Western Blot
Target Description: Romo1 induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. It may play a role in inducing oxidative DNA damage and replicative senescence.
Target Description: Romo1 induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. It may play a role in inducing oxidative DNA damage and replicative senescence.
Product Categories/Family for anti-ROMO1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8kDa
NCBI Official Synonym Full Names
calmodulin regulated spectrin-associated protein 1
NCBI Official Symbol
Camsap1
NCBI Official Synonym Symbols
C77823; PRO2405; 9530003A05Rik
NCBI Protein Information
calmodulin-regulated spectrin-associated protein 1
UniProt Protein Name
Calmodulin-regulated spectrin-associated protein 1
Protein Family
UniProt Gene Name
Camsap1
UniProt Entry Name
CAMP1_MOUSE
Uniprot Description
CAMSAP1: Plays a role in the regulation of cell morphology and cytoskeletal organization. Belongs to the CAMSAP1 family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Unknown function
Cellular Component: microtubule; cytoskeleton; cytoplasm
Molecular Function: calmodulin binding; spectrin binding; microtubule binding
Biological Process: regulation of cell morphogenesis; cytoskeleton organization and biogenesis; neurite development
Research Articles on ROMO1
Similar Products
Product Notes
The ROMO1 camsap1 (Catalog #AAA3213883) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Romo1 antibody - N-terminal region reacts with Tested Reactivity: Mouse Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Romo1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ROMO1 camsap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVAVGPYGQS QPSCFDRVKM GFVMGCAVGM AAGALFGTFS CLRIGMRGRE. It is sometimes possible for the material contained within the vial of "Romo1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
