Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RNF213Sample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human RNF213 Polyclonal Antibody | anti-RNF213 antibody

RNF213 Antibody - N-terminal region

Gene Names
RNF213; ALO17; MYMY2; MYSTR; NET57; C17orf27; KIAA1618
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RNF213; Polyclonal Antibody; RNF213 Antibody - N-terminal region; anti-RNF213 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETGNNSVQTVFQGTLAATKRWLREVFTKNMLTSSGASFTYVKEIEVWRRL
Sequence Length
1063
Applicable Applications for anti-RNF213 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RNF213
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RNF213Sample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RNF213Sample Type: Thyroid Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RNF213 antibody
This is a rabbit polyclonal antibody against RNF213. It was validated on Western Blot

Target Description: This gene encodes a protein containing a C3HC4-type RING finger domain, which is a specialized type of Zn-finger that binds two atoms of zinc and is thought to be involved in mediating protein-protein interactions. The protein also contains an AAA domain, which is associated with ATPase activity. This gene is a susceptibility gene for Moyamoya disease, a vascular disorder of intracranial arteries. This gene is also a translocation partner in anaplastic large cell lymphoma and inflammatory myofibroblastic tumor cases, where a t(2;17)(p23;q25) translocation has been identified with the anaplastic lymphoma kinase (ALK) gene on chromosome 2, and a t(8;17)(q24;q25) translocation has been identified with the MYC gene on chromosome 8.
Product Categories/Family for anti-RNF213 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
118kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF213 isoform 2
NCBI Official Synonym Full Names
ring finger protein 213
NCBI Official Symbol
RNF213
NCBI Official Synonym Symbols
ALO17; MYMY2; MYSTR; NET57; C17orf27; KIAA1618
NCBI Protein Information
E3 ubiquitin-protein ligase RNF213
UniProt Protein Name
E3 ubiquitin-protein ligase RNF213
UniProt Gene Name
RNF213
UniProt Synonym Gene Names
ALO17; C17orf27; KIAA1554; KIAA1618; MYSTR
UniProt Entry Name
RN213_HUMAN

NCBI Description

This gene encodes a protein containing a C3HC4-type RING finger domain, which is a specialized type of Zn-finger that binds two atoms of zinc and is thought to be involved in mediating protein-protein interactions. The protein also contains an AAA domain, which is associated with ATPase activity. This gene is a susceptibility gene for Moyamoya disease, a vascular disorder of intracranial arteries. This gene is also a translocation partner in anaplastic large cell lymphoma and inflammatory myofibroblastic tumor cases, where a t(2;17)(p23;q25) translocation has been identified with the anaplastic lymphoma kinase (ALK) gene on chromosome 2, and a t(8;17)(q24;q25) translocation has been identified with the MYC gene on chromosome 8. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011]

Uniprot Description

RNF213: Probable E3 ubiquitin-protein ligase that may play a role in angiogenesis. May also have an ATPase activity. Defects in RNF213 are the cause of susceptibility to Moyamoya disease type 2 (MYMY2). A progressive cerebral angiopathy characterized by bilateral intracranial carotid artery stenosis and telangiectatic vessels in the region of the basal ganglia. The abnormal vessels resemble a 'puff of smoke' (moyamoya) on cerebral angiogram. Affected individuals can develop transient ischemic attacks and/or cerebral infarction, and rupture of the collateral vessels can cause intracranial hemorrhage. Hemiplegia of sudden onset and epileptic seizures constitute the prevailing presentation in childhood, while subarachnoid bleeding occurs more frequently in adults. A chromosomal aberration involving ALO17 is associated with anaplastic large-cell lymphoma (ALCL). Translocation t(2;17)(p23;q25) with ALK. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; Oncoprotein; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: membrane; cytoplasm; nucleolus

Molecular Function: zinc ion binding; ATPase activity; ubiquitin-protein ligase activity; ligase activity

Biological Process: protein autoubiquitination; protein ubiquitination

Research Articles on RNF213

Similar Products

Product Notes

The RNF213 rnf213 (Catalog #AAA3208696) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF213 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RNF213 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNF213 rnf213 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETGNNSVQTV FQGTLAATKR WLREVFTKNM LTSSGASFTY VKEIEVWRRL. It is sometimes possible for the material contained within the vial of "RNF213, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.