Western Blot (WB)
(WB Suggested Anti-RNF128 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateRNF128 is supported by BioGPS gene expression data to be expressed in COLO205)
Rabbit RNF128 Polyclonal Antibody | anti-RNF128 antibody
RNF128 antibody - C-terminal region
Gene Names
RNF128; GRAIL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RNF128; Polyclonal Antibody; RNF128 antibody - C-terminal region; anti-RNF128 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASS
Sequence Length
402
Applicable Applications for anti-RNF128 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 93%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RNF128
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RNF128 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateRNF128 is supported by BioGPS gene expression data to be expressed in COLO205)
Western Blot (WB)
(WB Suggested Anti-RNF128 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysateRNF128 is supported by BioGPS gene expression data to be expressed in COLO205)
Related Product Information for anti-RNF128 antibody
This is a rabbit polyclonal antibody against RNF128. It was validated on Western Blot
Target Description: RNF128 is a type I transmembrane protein that localizes to the endocytic pathway. This protein contains a RING zinc-finger motif and has been shown to possess E3 ubiquitin ligase activity. Expression of RNF128 in retrovirally transduced T cell hybridoma significantly inhibits activation-induced IL2 and IL4 cytokine production. Induced expression of RNF128 was observed in anergic CD4(+) T cells, which suggested a role in the induction of anergic phenotype.
Target Description: RNF128 is a type I transmembrane protein that localizes to the endocytic pathway. This protein contains a RING zinc-finger motif and has been shown to possess E3 ubiquitin ligase activity. Expression of RNF128 in retrovirally transduced T cell hybridoma significantly inhibits activation-induced IL2 and IL4 cytokine production. Induced expression of RNF128 was observed in anergic CD4(+) T cells, which suggested a role in the induction of anergic phenotype.
Product Categories/Family for anti-RNF128 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF128 isoform 2
NCBI Official Synonym Full Names
ring finger protein 128, E3 ubiquitin protein ligase
NCBI Official Symbol
RNF128
NCBI Official Synonym Symbols
GRAIL
NCBI Protein Information
E3 ubiquitin-protein ligase RNF128
UniProt Protein Name
E3 ubiquitin-protein ligase RNF128
Protein Family
UniProt Gene Name
RNF128
UniProt Synonym Gene Names
GRAIL
UniProt Entry Name
RN128_HUMAN
NCBI Description
The protein encoded by this gene is a type I transmembrane protein that localizes to the endocytic pathway. This protein contains a RING zinc-finger motif and has been shown to possess E3 ubiquitin ligase activity. Expression of this gene in retrovirally transduced T cell hybridoma significantly inhibits activation-induced IL2 and IL4 cytokine production. Induced expression of this gene was observed in anergic CD4(+) T cells, which suggested a role in the induction of anergic phenotype. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Research Articles on RNF128
Similar Products
Product Notes
The RNF128 rnf128 (Catalog #AAA3214194) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF128 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RNF128 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNF128 rnf128 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PMCKCDILKA LGIEVDVEDG SVSLQVPVSN EISNSASSHE EDNRSETASS. It is sometimes possible for the material contained within the vial of "RNF128, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
