Western Blot (WB)
(Host: RabbitTarget Name: RMND5BSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Rabbit RMND5B Polyclonal Antibody | anti-RMND5B antibody
RMND5B Antibody - N-terminal region
Gene Names
RMND5B; GID2; GID2B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RMND5B; Polyclonal Antibody; RMND5B Antibody - N-terminal region; anti-RMND5B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELDKVLQKFLTYGQHCERSLEELLHYVGQLRAELASAALQGTPLSATLSL
Sequence Length
393
Applicable Applications for anti-RMND5B antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RMND5B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RMND5BSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RMND5BSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-RMND5B antibody
This is a rabbit polyclonal antibody against RMND5B. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-RMND5B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
E3 ubiquitin-protein transferase RMND5B isoform a
NCBI Official Synonym Full Names
required for meiotic nuclear division 5 homolog B
NCBI Official Symbol
RMND5B
NCBI Official Synonym Symbols
GID2; GID2B
NCBI Protein Information
E3 ubiquitin-protein transferase RMND5B; protein RMD5 homolog B
UniProt Protein Name
Protein RMD5 homolog B
Protein Family
UniProt Gene Name
RMND5B
UniProt Synonym Gene Names
UNQ2508/PRO5996
UniProt Entry Name
RMD5B_HUMAN
Similar Products
Product Notes
The RMND5B rmnd5b (Catalog #AAA3218918) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RMND5B Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RMND5B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RMND5B rmnd5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELDKVLQKFL TYGQHCERSL EELLHYVGQL RAELASAALQ GTPLSATLSL. It is sometimes possible for the material contained within the vial of "RMND5B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
