Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-MINA antibodyFormalin Fixed Paraffin Embedded Tissue: Human Small IntestinePrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit RIOX2 Polyclonal Antibody | anti-RIOX2 antibody

RIOX2 Antibody - C-terminal region

Gene Names
RIOX2; ROX; MDIG; MINA; NO52; JMJD10; MINA53
Reactivity
Dog, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RIOX2; Polyclonal Antibody; RIOX2 Antibody - C-terminal region; anti-RIOX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFPLSH
Sequence Length
211
Applicable Applications for anti-RIOX2 antibody
Western Blot (WB)
Homology
Dog: 79%; Human: 100%; Pig: 79%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MINA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-MINA antibodyFormalin Fixed Paraffin Embedded Tissue: Human Small IntestinePrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-MINA antibodyFormalin Fixed Paraffin Embedded Tissue: Human Small IntestinePrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-MINA antibodyFormalin Fixed Paraffin Embedded Tissue: Human ThyroidPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-MINA antibodyFormalin Fixed Paraffin Embedded Tissue: Human ThyroidPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(Host: RabbitTarget Name: MINASample Type: Breast Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MINASample Type: Breast Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RIOX2 antibody
This is a rabbit polyclonal antibody against MINA. It was validated on Western Blot

Target Description: MINA is a c-Myc (MYC; MIM 190080) target gene that may play a role in cell proliferation or regulation of cell growth. (Tsuneoka et al., 2002 [PubMed 12091391]; Zhang et al., 2005 [PubMed 15897898]).[supplied by OMIM, May 2008]
Product Categories/Family for anti-RIOX2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
ribosomal oxygenase 2 isoform a
NCBI Official Synonym Full Names
ribosomal oxygenase 2
NCBI Official Symbol
RIOX2
NCBI Official Synonym Symbols
ROX; MDIG; MINA; NO52; JMJD10; MINA53
NCBI Protein Information
ribosomal oxygenase 2
UniProt Protein Name
Bifunctional lysine-specific demethylase and histidyl-hydroxylase MINA
UniProt Gene Name
MINA
UniProt Synonym Gene Names
ROX
UniProt Entry Name
MINA_HUMAN

NCBI Description

MINA is a c-Myc (MYC; MIM 190080) target gene that may play a role in cell proliferation or regulation of cell growth. (Tsuneoka et al., 2002 [PubMed 12091391]; Zhang et al., 2005 [PubMed 15897898]).[supplied by OMIM, May 2008]

Uniprot Description

MINA: Involved in cellular proliferation. May play an important role in cell growth and survival. May be involved in ribosome biogenesis, most likely during the assembly process of pre-ribosomal particles. Belongs to the MINA53/NO66 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 3q11.2

Cellular Component: transcription factor complex; cytoplasm; nucleolus; cytosol; nucleus

Molecular Function: dioxygenase activity; metal ion binding

Biological Process: transcription, DNA-dependent; ribosome biogenesis and assembly; negative regulation of transcription from RNA polymerase II promoter

Research Articles on RIOX2

Similar Products

Product Notes

The RIOX2 mina (Catalog #AAA3200131) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RIOX2 Antibody - C-terminal region reacts with Dog, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RIOX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RIOX2 mina for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LTVLPDQDQS DEAQEKMVYI YHSLKNSRET HMMGNEEETE FHGLRFPLSH. It is sometimes possible for the material contained within the vial of "RIOX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.