Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RHOT2 AntibodyPositive Control: Lane 1: 20ug untransfected HEK293T Lane 2: 20ug RHOT2 transfected HEK293TPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2000Submitted by: Jin-Mi Heo)

Rabbit RHOT2 Polyclonal Antibody | anti-RHOT2 antibody

RHOT2 Antibody - N-terminal region

Gene Names
RHOT2; RASL; ARHT2; MIRO2; MIRO-2; C16orf39
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RHOT2; Polyclonal Antibody; RHOT2 Antibody - N-terminal region; anti-RHOT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TIPADVTPEKVPTHIVDYSEAEQTDEELREEIHKANVVCVVYDVSEEATI
Sequence Length
618
Applicable Applications for anti-RHOT2 antibody
Western Blot (WB)
Homology
Dog: 86%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Rat: 86%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RHOT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RHOT2 AntibodyPositive Control: Lane 1: 20ug untransfected HEK293T Lane 2: 20ug RHOT2 transfected HEK293TPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2000Submitted by: Jin-Mi Heo)

Western Blot (WB) (WB Suggested Anti-RHOT2 AntibodyPositive Control: Lane 1: 20ug untransfected HEK293T Lane 2: 20ug RHOT2 transfected HEK293TPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2000Submitted by: Jin-Mi Heo)
Related Product Information for anti-RHOT2 antibody
This is a rabbit polyclonal antibody against RHOT2. It was validated on Western Blot

Target Description: This gene encodes a member of the Rho family of GTPases. The encoded protein is localized to the outer mitochondrial membrane and plays a role in mitochondrial trafficking and fusion-fission dynamics.
Product Categories/Family for anti-RHOT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
mitochondrial Rho GTPase 2 isoform 2
NCBI Official Synonym Full Names
ras homolog family member T2
NCBI Official Symbol
RHOT2
NCBI Official Synonym Symbols
RASL; ARHT2; MIRO2; MIRO-2; C16orf39
NCBI Protein Information
mitochondrial Rho GTPase 2
UniProt Protein Name
Mitochondrial Rho GTPase 2
UniProt Gene Name
RHOT2
UniProt Synonym Gene Names
ARHT2; C16orf39; MIRO-2; hMiro-2
UniProt Entry Name
MIRO2_HUMAN

NCBI Description

This gene encodes a member of the Rho family of GTPases. The encoded protein is localized to the outer mitochondrial membrane and plays a role in mitochondrial trafficking and fusion-fission dynamics. [provided by RefSeq, Nov 2011]

Uniprot Description

RHOT2: Mitochondrial GTPase involved in mitochondrial trafficking. Probably involved in control of anterograde transport of mitochondria and their subcellular distribution. Belongs to the mitochondrial Rho GTPase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; G protein, monomeric, Rho; Membrane protein, integral; G protein, monomeric; EC 3.6.5.-; Mitochondrial; G protein

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: membrane; plasma membrane; cytosol; integral to mitochondrial outer membrane

Molecular Function: GTPase activity; protein binding; GTP binding; calcium ion binding

Biological Process: regulation of small GTPase mediated signal transduction; metabolic process; small GTPase mediated signal transduction; cellular homeostasis; mitochondrion transport along microtubule

Research Articles on RHOT2

Similar Products

Product Notes

The RHOT2 rhot2 (Catalog #AAA3215576) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHOT2 Antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RHOT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RHOT2 rhot2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TIPADVTPEK VPTHIVDYSE AEQTDEELRE EIHKANVVCV VYDVSEEATI. It is sometimes possible for the material contained within the vial of "RHOT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.